PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G35260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 360aa    MW: 38483.9 Da    PI: 9.7632
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G35260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-15280328553
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                      +r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ +e+ 
  ORUFI02G35260.1 280 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEML 328
                      79***************************************98876643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-14276341IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.197278330IPR004827Basic-leucine zipper domain
PfamPF001702.7E-13280330IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.88E-11280330No hitNo description
CDDcd147071.32E-24280332No hitNo description
Gene3DG3DSA:1.20.5.1708.7E-15280331No hitNo description
PROSITE patternPS000360283298IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MDFPGGSGRQ QQQQQLPPMT PLPLARQGSV YSLTFDEFQS TLGGVGKDFG SMNMDELLRS  60
IWTAEESHAV GAATTTTATT ASVAAAEHAA VGAPPVQRQG SLTLPRTLSQ KTVDEVWRDM  120
MCFGGGGAST APAAAEPPPP AHRQQTLGEI TLEEFLVRAG VVREDMSVPP VPPAPTPTAA  180
AVPPPPPPQQ QTPMLFGQSN VFPPMVPPLS LGNGLVSGAV GHGGGGAASL VSPVRPVSSN  240
GFGKMEGGDL SSLSPSPVPY VFKGGLRGRK APGIEKVVER RQRRMIKNRE SAARSRQRKQ  300
AYMMELEAEV AKLKELNDEL QKKQDEMLEQ QKNEVLERMS RQVGPTAKRI CLRRTLTGPW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7796380.0KP779638.1 Oryza nivara OsbZIP23 (bZIP23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625853.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ6ZDF32e-67TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A0E0GCC60.0A0A0E0GCC6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0GCC70.0A0A0E0GCC7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NLD10.0A0A0E0NLD1_ORYRU; Uncharacterized protein
STRINGBGIOSGA005551-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.28e-43ABRE binding factor 4