PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G34050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 386aa    MW: 43426.2 Da    PI: 8.3742
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G34050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.2e-53161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      + pGfrFhPtdeelv +yL++k+++k+l++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s
  ORUFI02G34050.1  16 MLPGFRFHPTDEELVRFYLRRKIQQKSLPI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSTRPNRVTGAGFWKATGTDRPIYS 108
                      579***************************.89***************9888999*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  ORUFI02G34050.1 109 SdGSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 143
                      966677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5911175IPR003441NAC domain
PROSITE profilePS5100556.9216175IPR003441NAC domain
PfamPF023651.3E-2518143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MDEMRSSDIE KQDEVMLPGF RFHPTDEELV RFYLRRKIQQ KSLPIELIRQ LDIYKYDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSTRPNR VTGAGFWKAT GTDRPIYSSD GSKCIGLKKS  120
LVFYKGRAAK GVKTDWMMHE FRLPSLTDPS LPQKKPLEKI IPPNDSWAIC RIFKKTNSTA  180
QRALSHSWVS PPLSSTNEAY TAPVSQTTQR SQHISDNTSS VMTDAISSTI QFTGSSYLPS  240
TVPSCHNPLS MIDSNSRPDA SVPLPSPVAE HQTMGILSAI PLDITAGIDI ASMVFNASSF  300
TLPNMDRMTA NIEFGQPQKC NSSSSMTNRC VVDMPDVANN INSGPRSINF NLQGTLSDDW  360
RMTLPWESLP CTTEVSTNFQ STKCYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-5311781171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0041140.0AP004114.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1118_G04.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878685.10.0putative NAC domain-containing protein 94
SwissprotQ9FIW51e-105NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A0E0NKX40.0A0A0E0NKX4_ORYRU; Uncharacterized protein
STRINGORUFI02G34050.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137172629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-107NAC domain containing protein 94