PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G22950.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 88aa    MW: 9919.43 Da    PI: 10.6243
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G22950.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.15.7e-291059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyeyss
  ORUFI02G22950.5 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSS 59
                     8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-33282IPR002100Transcription factor, MADS-box
CDDcd002652.23E-43277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLMIFSS TGRLYEYSST  60
SMKSVIDRYG KSKDEQQAVA NPNSELKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-22183183MEF2C
5f28_B4e-22183183MEF2C
5f28_C4e-22183183MEF2C
5f28_D4e-22183183MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519231e-147AY551923.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS218 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626695.15e-57MADS-box transcription factor 27
SwissprotQ6EP495e-58MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0D3F6V33e-57A0A0D3F6V3_9ORYZ; Uncharacterized protein
STRINGOGLUM02G22050.11e-56(Oryza glumipatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.17e-47AGAMOUS-like 21
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]