PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G22930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 348aa    MW: 37434.3 Da    PI: 7.2899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G22930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.3e-53151411128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +k+ +    +++++ e+d++k+ePwdLp++++ +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkd+e+++
  ORUFI02G22930.1  15 LPPGFRFHPTDEELITHYLLRKAVDPAGFAARAVGEADLNKCEPWDLPSRATMGEKEWYFFCVKDRKYPTGLRTNRATESGYWKATGKDREIFR 108
                      79*******************988887555589***************988899**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++lvg+kktLvfy+grap+g kt Wvmheyr+
  ORUFI02G22930.1 109 -GKALVGMKKTLVFYTGRAPRGGKTGWVMHEYRI 141
                      .99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-639163IPR003441NAC domain
PROSITE profilePS5100559.71115163IPR003441NAC domain
PfamPF023654.4E-2916141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MRLARQQQQQ QEMDLPPGFR FHPTDEELIT HYLLRKAVDP AGFAARAVGE ADLNKCEPWD  60
LPSRATMGEK EWYFFCVKDR KYPTGLRTNR ATESGYWKAT GKDREIFRGK ALVGMKKTLV  120
FYTGRAPRGG KTGWVMHEYR IHGKHAAANS KDQEWVLCRV FKKSLELAAP AAAGRRGAGA  180
GTDVGPSSMP MADDVVGLAP CALPPLMDVS GGGAGTASLS ATAGAAAAPP PAHVTCFSNA  240
MEGQFLDTPY LLPAADPADH LAMSSASPFL EALQMQYVQD AAAAAGGAGM VHELLMGGGW  300
YCNKGERERL SGASQDTGLT SSEVNPGEIS SSSRQQRMDH HDASLWAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-541216317168NAC domain-containing protein 19
3swm_B2e-541216317168NAC domain-containing protein 19
3swm_C2e-541216317168NAC domain-containing protein 19
3swm_D2e-541216317168NAC domain-containing protein 19
3swp_A2e-541216317168NAC domain-containing protein 19
3swp_B2e-541216317168NAC domain-containing protein 19
3swp_C2e-541216317168NAC domain-containing protein 19
3swp_D2e-541216317168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8347650.0CT834765.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA021O03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623390.10.0NAC domain-containing protein 92 isoform X2
SwissprotQ9FLJ23e-89NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0E0NGV70.0A0A0E0NGV7_ORYRU; Uncharacterized protein
STRINGOBART02G21850.10.0(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-84NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]