PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G20570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 311aa    MW: 33689.8 Da    PI: 7.7027
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G20570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.71e-071902371462
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      R + +rsR RK+++i+ Le+ v++L+  N aL  e+++l+ ++ +l++ 
  ORUFI02G20570.1 190 RRSGQRSRVRKLQYIADLERTVDSLQLRN-ALSMENKQLRRQITSLQQA 237
                      67889************************.7*************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147034.24E-14189238No hitNo description
Gene3DG3DSA:1.20.5.1704.1E-7190236No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSLFTQSC RFPSEDPFVG EPPCWLDDLL ADSGKSHTLP  60
PLRRACSDSD AILDVLTSFQ SPIYPIDEGD PQPVGEAGES FNAAAEGGGS GAGIEGSCVY  120
GPNSPRQKTR LTSSESSMVN AVLENVPSNP LQYLMIDATS GVNCNVGAAN GTGDTGDAVC  180
HADQEKSLKR RSGQRSRVRK LQYIADLERT VDSLQLRNAL SMENKQLRRQ ITSLQQAKLI  240
KDGQTQMLKK ETERLKQLSV RHRRSRSVTS CFEANSFGGG DPSAINWQML DMSKLSLNGG  300
AVVPPRGGYG M
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195RRSGQRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3248080.0HQ324808.1 Oryza sativa Japonica Group clone KCS608G03 b-zip protein mRNA, complete cds.
GenBankAK0636440.0AK063644.1 Oryza sativa Japonica Group cDNA clone:001-118-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623493.10.0PREDICTED: basic leucine zipper 34
TrEMBLA0A0E0NG260.0A0A0E0NG26_ORYRU; Uncharacterized protein
STRINGLOC_Os02g33560.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.23e-14bZIP family protein