PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G10470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 272aa    MW: 28347 Da    PI: 6.4055
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G10470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.7e-11145191551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++  
  ORUFI02G10470.1 145 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQMEVSALSPRVAF 191
                      899**********************************9999877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-13141205IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.611143199IPR004827Basic-leucine zipper domain
PfamPF001707.3E-10145195IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-13145199No hitNo description
SuperFamilySSF579591.2E-11145199No hitNo description
CDDcd147031.51E-20146196No hitNo description
PROSITE patternPS000360148163IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAQLPPRAPS AAAAAGQEWS AMAAAGEFLG FAAARRGAHR RSASDSAAFL MEAAVPMDDV  60
IVGVGGGGEF DRLDDEQLMS MFSDVEAPAV SDGGGGGGER GPAGEAHLMD MGDGDDGMGA  120
TSPAGAGAMA AAAAAAAADG IADPKRVKRI LANRQSAQRS RVRKLQYISE LERSVTTLQM  180
EVSALSPRVA FLDHQRSLLT VGNSHLKQRI AALAQDKIFK DAHQEALKKE IERLRQVYHQ  240
QQIKATGGAD IATAASMQAK HELLACEGAA MR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622790.11e-140PREDICTED: basic leucine zipper 19
SwissprotQ6K3R91e-141BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A0E0NCD70.0A0A0E0NCD7_ORYRU; Uncharacterized protein
STRINGLOC_Os02g14910.11e-139(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-57bZIP family protein