PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G06390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 249aa    MW: 26086.2 Da    PI: 10.2093
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G06390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.93.8e-071481902163
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R RKk+++   ++ v +L  eN++L++e+ +l+  +a+l +e+
  ORUFI02G06390.1 148 RPRKKMRLPDVQQLVRSLAVENDSLREEMRTLQRACAALSKEN 190
                      89*************************************9997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDCAGDDDAV AAGIICSLRG ADLAGWTPPW WCSSSSKGAA REELIWPPVT RGKRSRRRSP  60
SAVAAAAGKK GRWARASPAS PLDYSGGSGS GSGSGSGSAA STSGGEDGTF CSPPGHRPAP  120
ATTKVGAMGR QQQLPFSAPS PLRPAGQRPR KKMRLPDVQQ LVRSLAVEND SLREEMRTLQ  180
RACAALSKEN DKLEIRLQIS SSRNKPMITE DLKGKQQIDQ QSATQSIGGG FALPDLNIPV  240
QDAADGSVH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147153RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1076300.0AK107630.1 Oryza sativa Japonica Group cDNA clone:002-131-E03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626239.11e-178PREDICTED: uncharacterized protein LOC4328519 isoform X1
TrEMBLA0A0E0NAT71e-179A0A0E0NAT7_ORYRU; Uncharacterized protein
STRINGORGLA02G0057900.11e-177(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951