PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G05030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 286aa    MW: 30765.7 Da    PI: 6.741
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G05030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.12e-223074145
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     k ienk  rqv fskRr+g++KKA+ELSvLC+a+vav+ fs+ g+
  ORUFI02G05030.1 30 KLIENKEARQVCFSKRREGVFKKASELSVLCGARVAVVFFSPAGR 74
                     569***************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.8382282IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-282281IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-262391IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-172444IPR002100Transcription factor, MADS-box
CDDcd002652.36E-302791No hitNo description
PfamPF003191.8E-243278IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-174459IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-175980IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MAKAAAEMDV GGGEGRRRKR TRGRQRIEMK LIENKEARQV CFSKRREGVF KKASELSVLC  60
GARVAVVFFS PAGRPHCFGH PSVSAVADRF LLGRSPADAA AAAAEEEEAV VREFNRVEER  120
LKDALGAAAR RRDALDEAAR VAGVWNDADV RRAGLADLVS MLAALQRVQA EASERVHDII  180
VEEAMTHYTG AAAAAANLID YLDAGPFVSH SPGSHDTTTK LIGGNAVHAP PLSFPPMIMP  240
PPLPPQFSHG FGYTDLAAGY GYNLDHGHGA AYETEEFHNA AACDFF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11525RRRKRTRGRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040930.0AP004093.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1661_C12.
GenBankAP0048630.0AP004863.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0023I17.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878655.10.0agamous-like MADS-box protein AGL28
TrEMBLA0A0E0NAA20.0A0A0E0NAA2_ORYRU; Uncharacterized protein
STRINGORUFI02G05030.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-21AGAMOUS-like 29