PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G03770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 681aa    MW: 76150.9 Da    PI: 7.4478
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G03770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-09445490752
                      --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
         Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                      + +  +e+L ++F++n  p ++ +e L+++lg++ +++  WF+N R
  ORUFI02G03770.1 445 IPPAAVEVLRKAFAENELPARSVKENLSTELGISFEKIDKWFKNTR 490
                      567789**************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.55E-8182253IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.8E-7194252IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500168.805195251IPR019787Zinc finger, PHD-finger
Gene3DG3DSA:1.10.10.607.5E-12427490IPR009057Homeodomain-like
PROSITE profilePS5007112.26436496IPR001356Homeobox domain
SMARTSM003893.7E-9438500IPR001356Homeobox domain
SuperFamilySSF466891.15E-9438502IPR009057Homeodomain-like
CDDcd000862.76E-8439500No hitNo description
PfamPF000461.0E-6444490IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MNTPEKKPLC YTSRRALQQR TESSSELISV SKRATRQNTP RKPDSPPKRT TRSSANLAKC  60
IENKHHSSPL KRRRGSDAAT GKSATGPTRR KHKQKRKNDE SDEVSRMEKR ARYLLIKIKQ  120
EQNLLDAYSG DGWNGHSREK IKPEKELQRA KKQIMKYKIA IRDVIHQLDL CSSSGSKDDS  180
VIPPDGCHES VNPEHTICSR CKSHESFPDN NIIFCEGGCK LACHQKCLEP PFDKILPTTR  240
HGRLCKHCSS KMKILDAINA HLGTSFTVKC PSSDIFKEAA EHFNSDDGLG QDWLSEYSGD  300
EDYDPEENEA SSSGEENKSA DSNCSGSPLY SPNDDIPDFI SADFNDAEGF CRESSNLGID  360
FGEDGLAEIL THQRPRRDVD YTQLNEQMFG EPIGNDEQSE DEDWGLNKRK KRRTGSTGVG  420
TNSVEGRSDV KSNKKAQPRR KLFRIPPAAV EVLRKAFAEN ELPARSVKEN LSTELGISFE  480
KIDKWFKNTR CAALRDRKGE SRYSGPSKRS RTSIEKAETS AKVDQMDNSC FLPLSEIINV  540
PTRLQKGLDK KPKSINSPPR PQDNETCLSP TDKTKEGTPP TIKPSITDSS QLMNNNIGTE  600
ETAVSWVDTW ASDALHFLDV SDDEHFFDVI EKVCGLENRL QRLKENMLSS SSSTDNNVAA  660
ESGLQNEVVL VPAAELKDKA S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402070.0FJ940207.1 Oryza sativa Japonica Group clone KCS002D03 homeodomain protein mRNA, complete cds.
GenBankAK0988550.0AK098855.1 Oryza sativa Japonica Group cDNA clone:J013000I05, full insert sequence.
GenBankAK0705020.0AK070502.1 Oryza sativa Japonica Group cDNA clone:J023051F17, full insert sequence.
GenBankAK0652570.0AK065257.1 Oryza sativa Japonica Group cDNA clone:J013002J16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626817.10.0PREDICTED: pathogenesis-related homeodomain protein
TrEMBLA0A0E0N9U10.0A0A0E0N9U1_ORYRU; Uncharacterized protein
TrEMBLB8AHR50.0B8AHR5_ORYSI; Putative uncharacterized protein
TrEMBLQ6Z4410.0Q6Z441_ORYSJ; Homeodomain protein
STRINGBGIOSGA007535-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os02g05450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85502227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.23e-56pathogenesis related homeodomain protein A