PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G02260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 335aa    MW: 35915 Da    PI: 5.2405
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G02260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.93.3e-11217247131
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeL 31 
                      e+elk+++rkq+NRe+ArrsR+RK+  ++ L
  ORUFI02G02260.1 217 ERELKKQKRKQSNRESARRSRLRKQNIMDSL 247
                      89***********************999887 PP

2bZIP_130.86.4e-102552942463
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  24 KkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      ++ae+eeL  ++++L aeN++L+ ele++kke+++l s++
  ORUFI02G02260.1 255 FQAECEELSVRADNLRAENSSLRAELERIKKEYEALLSHN 294
                      59**********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077774.9E-18175IPR012900G-box binding protein, multifunctional mosaic region
PfamPF165961.1E-2096199No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-13215291No hitNo description
PfamPF001705.9E-9217247IPR004827Basic-leucine zipper domain
SMARTSM003388.8E-12217296IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.53E-6220278No hitNo description
CDDcd147021.52E-20222287No hitNo description
PROSITE patternPS000360224239IPR004827Basic-leucine zipper domain
PfamPF001704.6E-7256294IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGTNDPGTPS KATKASEPEQ SPATTSGTTA PVYPEWPGFQ AYSAIPPHGF FPPPVAASPQ  60
AHPYMWGAQG VHPFNHYPML ANGNVETAGT APGASEINGK NELGRTSGPS ANGITSHSES  120
GSESESEGSD ANSQNDSHSK ENDVKEDGSS QNGISHTALN QNMSMAPTQT GVVIGGVAPT  180
TNLNIGMDYW GAAGSSPVPA MHGKASSGSV RGEQWDEREL KKQKRKQSNR ESARRSRLRK  240
QNIMDSLIEA PKYLFQAECE ELSVRADNLR AENSSLRAEL ERIKKEYEAL LSHNASLKEK  300
LEGNSDSIPY MNEQNDTNGT HQKQQDSDAQ PNDAP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1233239RRSRLRK
2233240RRSRLRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1120090.0AK112009.1 Oryza sativa Japonica Group cDNA clone:006-209-B12, full insert sequence.
GenBankAK1119010.0AK111901.1 Oryza sativa Japonica Group cDNA clone:J023076M20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626323.10.0PREDICTED: transcription factor HBP-1a
RefseqXP_015626324.10.0PREDICTED: transcription factor HBP-1a
SwissprotP239221e-138HBP1A_WHEAT; Transcription factor HBP-1a
TrEMBLA0A0D9YLQ10.0A0A0D9YLQ1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N9870.0A0A0E0N987_ORYRU; Uncharacterized protein
STRINGBGIOSGA007448-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os02g03580.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21473796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32150.18e-53basic region/leucine zipper transcription factor 68