PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G45590.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 164aa    MW: 18363.5 Da    PI: 10.2755
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G45590.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.62.2e-251160251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rie+k  rqv fskRr+g++KKA+EL  LCd+eva+++fs+ gklyeyss
  ORUFI01G45590.2 11 RIEDKASRQVRFSKRRAGLFKKAFELALLCDVEVALLVFSPVGKLYEYSS 60
                     8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.132262IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-31261IPR002100Transcription factor, MADS-box
CDDcd002651.02E-37379No hitNo description
PRINTSPR004045.6E-26424IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-29480IPR002100Transcription factor, MADS-box
PfamPF003191.8E-241158IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-262439IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-263960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MARRGRVQLR RIEDKASRQV RFSKRRAGLF KKAFELALLC DVEVALLVFS PVGKLYEYSS  60
SSIEGTYDRY QQFAGARRDL NEGSTSINSD ENASIHSRLR DITAWSLQNN ADESDANQLE  120
KLEKLLTNAL RDTKSKKMLA KQNGEGSRSR ANSSGSRGQE EGSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-18473372MEF2C
5f28_B2e-18473372MEF2C
5f28_C2e-18473372MEF2C
5f28_D2e-18473372MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033270.0AB003327.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:S10304.
GenBankAK0661600.0AK066160.1 Oryza sativa Japonica Group cDNA clone:J013055I02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878223.11e-111MADS-box transcription factor 51
SwissprotQ9XJ611e-117MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBLA0A0E0N6Y71e-114A0A0E0N6Y7_ORYRU; Uncharacterized protein
STRINGOS01T0922800-011e-115(Oryza sativa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.13e-30AGAMOUS-like 79
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SL,Lee S,Kim HJ,Nam HG,An G
    OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a.
    Plant Physiol., 2007. 145(4): p. 1484-94
    [PMID:17951465]