PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G38120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 344aa    MW: 36796.2 Da    PI: 10.0163
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G38120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.8e-16274324556
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN +Lk + +el +++
  ORUFI01G38120.1 274 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENVRLK-RQKELDELI 324
                      79***************************************9.666666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-14269317No hitNo description
SMARTSM003388.0E-11270342IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.392272317IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.94E-11274319No hitNo description
CDDcd147076.03E-25274328No hitNo description
PfamPF001706.5E-13274317IPR004827Basic-leucine zipper domain
PROSITE patternPS000360277292IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGSQTMASKA GGGGVARRGG GRMRSLGRQG SMYSLTLDEV QSQLGEPLHS MNLDELLRSV  60
FPDGLAIADG AGAGAGATTS SQQHQPGSGL LRQGSITMPP ELSKNTVDEV WKGIQAAPKR  120
NAETGGGGGG GRRRRERQPT LGEVTLEDFL VKAGVVTQGS LKELSDVGNV DPVGRGVTAT  180
GTVDLAPGSH WIEQYKQQIA STDAHHHGQQ GVQGAYFPNR LVPQPLNVGP GAILEPSYSD  240
GQTSSGMIGG MSDSQTPGRK RGMSGDVADK LMERRQKRMI KNRESAARSR ARKQAYTNEL  300
ENKVSRLEEE NVRLKRQKEL DELICAVPVP EPKYQLRRTS SADF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130137GRRRRERQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627754.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES38e-82AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0E0N3Z20.0A0A0E0N3Z2_ORYRU; Uncharacterized protein
STRINGLOC_Os01g59760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-71ABA-responsive element binding protein 3