PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G34980.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 620aa    MW: 66932.1 Da    PI: 8.9805
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G34980.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR40.94.1e-13158196241
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      +kk CnCk+skClk+YCeCfa+g++C+  C+C++C+N+ +
  ORUFI01G34980.3 158 KKKCCNCKHSKCLKLYCECFASGVYCDG-CNCSNCFNNVK 196
                      799*************************.********987 PP

2TCR50.83.3e-16242281140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  ORUFI01G34980.3 242 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 281
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-14157197IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.003158282IPR005172CRC domain
PfamPF036381.7E-9159194IPR005172CRC domain
SMARTSM011148.4E-20242283IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12245280IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MAGKEQQGGG GPPPPPRAPV PAASSQPPIK KLVRQLDFTS AALAGNPAMA AAAAAVSRAL  60
QPRAVPVGFP QPQQLRAHLP VGVPQQLHPR GLPVMRSHHV VHVPLPRPAV AVAVPVPQVR  120
PAQPQPVPRP PVAVPLKPES PKPPRARLYE GKDGTPTKKK CCNCKHSKCL KLYCECFASG  180
VYCDGCNCSN CFNNVKNETA RREAIDATLE RNPDAFRPKI GSSPHANRNN MEAAGDLPLV  240
GKHNKGCHCK KSGCLKKYCE CFQANILCSE NCKCMDCKNF EGSEERKALF QGDHKNSIHM  300
QQAANAAVNG AIGGAAFSSP STSRKRKHID PSLDHSAKEN GAHRTNHVPQ KNGMPSDGPL  360
PINQPVHPPT LGPFKVTYRP LLADIVQPGD VKELCKLLVV VSGNAAKAYA GKKSQEDKVV  420
EKEDEMGGKR EGEIGGSLAS TNHDREENNK DPNNQKASAD DPSTGGTRAG KASLEESKHD  480
CNDDQKSNRP MSPGTLALMC DEQDTMFMTS QNVVPQQPAP VNQNQSELYA EQERCVLTEF  540
RDCLHKLVTF GRMKEEKFSM AIKSEVPAHP MQANGVSRIP YSKEVDVPVV KTFLQSSSRH  600
PAAGNSATGH LDKKPKHENT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1221120.0AK122112.1 Oryza sativa Japonica Group cDNA clone:J033127O09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621699.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
TrEMBLA0A0E0N2S30.0A0A0E0N2S3_ORYRU; Uncharacterized protein
STRINGORGLA01G0258000.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-122Tesmin/TSO1-like CXC domain-containing protein