PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G34290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 557aa    MW: 62126.1 Da    PI: 5.0959
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G34290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ430.23.1e-1322584751217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p p+afl+pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip+cegaatakspwna+
  ORUFI01G34290.1 258 PVPAAFLRPKCALWDCPRPAQGSERWQDYCSMYHADLAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPVCEGAATAKSPWNAP 351
                      89*************************************9879*************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdl ++ege+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqps+s+ewhlyeyein++da+alyrle+
  ORUFI01G34290.1 352 ELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINDCDAFALYRLEF 445
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d+kk+ak+k+++++l+++q++++rl+a
  ORUFI01G34290.1 446 KSSDAKKTAKSKLACNPLNEIQQQMVRLSA 475
                      ****************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MGRGPAAGRS SAGAARHQQF RARAKTRVDD LQEMFSGLQS ARKEARSTDA AVLEAQLHQM  60
LREWRAELSQ GNNRELSDPP SETLRLLQLA AAEEEEDDAT SKLVEQQQQH PPSANQAHGH  120
PQAQGGQDMK PEPPEEAVAS PADLTVPQQP QSPGQGVLAS GGGMLAPAAA AVFHDQMYYV  180
NQELTVEDFL YDDNYKMYLP GYNSDVLNNL ESTGQLEYPQ FNLPQELPPN AYLDTSNCGQ  240
NAGDVFLHMS DLLNTMSPVP AAFLRPKCAL WDCPRPAQGS ERWQDYCSMY HADLAVKEEG  300
PPGTMPVIRP RGIDLKDGPL FAALSAKIQG KHVGIPVCEG AATAKSPWNA PELFDLYIFE  360
GESIREWLFF DKPRRAFESG NRKQRSLPDY NGRGWHESRK QVMKDFGGLK RSYYMDPQPS  420
NSYEWHLYEY EINDCDAFAL YRLEFKSSDA KKTAKSKLAC NPLNEIQQQM VRLSADSPVE  480
NKRSARSRTK ANPNDINSNI YLVQNTTVQG SIPNAYQAVS QPDQMTYLNG NVVYGPHLPY  540
GYSTERSDFY WSSNDGA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417650.0AK241765.1 Oryza sativa Japonica Group cDNA, clone: J065205E23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621735.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-147VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0D9YF220.0A0A0D9YF22_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FT900.0A0A0E0FT90_ORYNI; Uncharacterized protein
TrEMBLA0A0E0N2I80.0A0A0E0N2I8_ORYRU; Uncharacterized protein
STRINGOGLUM01G35310.10.0(Oryza glumipatula)
STRINGORUFI01G34290.10.0(Oryza rufipogon)
STRINGONIVA01G35590.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-135vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]