PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G18470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 333aa    MW: 37382.6 Da    PI: 6.7805
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G18470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.61.7e-55141421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      lppGfrFhPtdee++++yL++kv +++  +  +i evd++k+ePwdLp k+  ++ekewyf++++d+ky+tg r+nrat++gyWkatgkdke++
  ORUFI01G18470.1  14 LPPGFRFHPTDEEIITFYLAPKVVDSRGFCVAAIGEVDLNKCEPWDLPgKAKMNGEKEWYFYCQKDRKYPTGMRTNRATEAGYWKATGKDKEIF 107
                      79********************99999556588***************544445788************************************* PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++ l+g+kktLvfykgrapkg kt+Wvmheyrl
  ORUFI01G18470.1 108 RNHHMLIGMKKTLVFYKGRAPKGDKTNWVMHEYRL 142
                      *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6210173IPR003441NAC domain
PROSITE profilePS5100559.40514173IPR003441NAC domain
PfamPF023653.2E-2815142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGEQQQQVER QPDLPPGFRF HPTDEEIITF YLAPKVVDSR GFCVAAIGEV DLNKCEPWDL  60
PGKAKMNGEK EWYFYCQKDR KYPTGMRTNR ATEAGYWKAT GKDKEIFRNH HMLIGMKKTL  120
VFYKGRAPKG DKTNWVMHEY RLADASPPQP PPPPSSAEPP RQDDWAVCRI FHKSSGIKKP  180
VQVPMQMPMQ MQMPVAHQVP AANYQQQMAM ASASIIQVPM QMQMPSMSDQ LQMLDDFSTG  240
SLMAPPPPPP SYSTLPGFPL QINGGAQQFV GNPSMYYQQQ QQQQQQQMDM AAGGFVVSEP  300
SSLVVSPQDA ADQNNAADIS SVACNMDATI WKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-5211794171NO APICAL MERISTEM PROTEIN
1ut4_B8e-5211794171NO APICAL MERISTEM PROTEIN
1ut7_A8e-5211794171NO APICAL MERISTEM PROTEIN
1ut7_B8e-5211794171NO APICAL MERISTEM PROTEIN
3swm_A8e-5211797174NAC domain-containing protein 19
3swm_B8e-5211797174NAC domain-containing protein 19
3swm_C8e-5211797174NAC domain-containing protein 19
3swm_D8e-5211797174NAC domain-containing protein 19
3swp_A8e-5211797174NAC domain-containing protein 19
3swp_B8e-5211797174NAC domain-containing protein 19
3swp_C8e-5211797174NAC domain-containing protein 19
3swp_D8e-5211797174NAC domain-containing protein 19
4dul_A8e-5211794171NAC domain-containing protein 19
4dul_B8e-5211794171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469950.0EU846995.1 Oryza sativa Japonica Group clone KCS259A08 NAC protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629856.10.0NAC domain-containing protein 79
SwissprotQ9FK442e-78NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0E0FLS50.0A0A0E0FLS5_ORYNI; Uncharacterized protein
TrEMBLA0A0E0MWS60.0A0A0E0MWS6_ORYRU; Uncharacterized protein
TrEMBLA2WQE40.0A2WQE4_ORYSI; NAC protein
STRINGORUFI01G18470.10.0(Oryza rufipogon)
STRINGONIVA01G18370.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.23e-78Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]