PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G15840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 421aa    MW: 44491.3 Da    PI: 5.4521
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G15840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.91.5e-141648840
                     HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
           SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviif 40
                     +r  tf++R+++++K A+ELSvLCda+vav++ 
  ORUFI01G15840.1 16 KRAATFARRKETVMKMAKELSVLCDAQVAVVVG 48
                     6899**************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.62E-15161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.825161IPR002100Transcription factor, MADS-box
SMARTSM004325.2E-10160IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-7323IPR002100Transcription factor, MADS-box
CDDcd002661.00E-20387No hitNo description
PfamPF003196.0E-131552IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MPRAKTPMGL IPFPKKRAAT FARRKETVMK MAKELSVLCD AQVAVVVGNP GGGAAEKAAW  60
ESEEGVRAKR SLTHREYLRG ELRKQRAKLA KVREEGAFKP WDDALDGIAE EETRKLHKYL  120
SDKIEAARAR MEAMGLQLGD VDDNGVNGDD GGGLDLQQHV PPSASDAKEF ESVPVVHGGQ  180
YIGSSSGGGG GDIQMQTTPA ADGISFSEQY VPPPWEWDGT FPSQPQAVQP EHGIQYNAPM  240
EGYPSQVPGN GLPDLATGSI DVAAAAAATT APARYPPTLD TGRHGSFLVA PRAQPLAFST  300
AGADFINAPN NFLTTGVSVS DYSVQSSGYG IGNQIDNAKQ LLYQMQMQYP VGGTGGAEPS  360
NTQTQSPDLR SFSNVVGDYS YTAAQSSANR LDQMHHPVGG RGSTGGAAAD PSDTQSKNRG  420
S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0033310.0AP003331.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1088D01.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0MVV00.0A0A0E0MVV0_ORYRU; Uncharacterized protein
STRINGORUFI01G15840.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31640.14e-08AGAMOUS-like 92