PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G11090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 527aa    MW: 58935.9 Da    PI: 6.0117
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G11090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.15.1e-51471741128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGf FhP+d el+++yLkkk++g+k+e  e+i+evdiyk+ePwdLp+   v +++++w+fF+ rd+ky++g+r+nrat +gyWk+tgkd+++
  ORUFI01G11090.1  47 LPPGFGFHPKDTELISHYLKKKIHGQKIEY-EIIPEVDIYKHEPWDLPAkcDVPTQDNKWHFFAARDRKYPNGSRSNRATVAGYWKSTGKDRAI 139
                      79****************************.99***************5356667999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +  +++++g+kktLvf++gr p+g++t+W+mhey +
  ORUFI01G11090.1 140 KM-GKQTIGTKKTLVFHEGRPPTGRRTEWIMHEYYI 174
                      *9.99*****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5936197IPR003441NAC domain
PROSITE profilePS5100555.53447197IPR003441NAC domain
PfamPF023651.2E-2448173IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MASMANQHQL RGTRRSARAR GGCTGEPSRR AAARLWFFSE SLRDMVLPPG FGFHPKDTEL  60
ISHYLKKKIH GQKIEYEIIP EVDIYKHEPW DLPAKCDVPT QDNKWHFFAA RDRKYPNGSR  120
SNRATVAGYW KSTGKDRAIK MGKQTIGTKK TLVFHEGRPP TGRRTEWIMH EYYIDERECQ  180
ACPDMKDAYV LCRITKRNDW IPGNGNELDN SDPHPEPCDA PPSVISTEQL NPDAEPVVGV  240
EAAPVTVAEP DGVTTSAITA NIPSPSDGIN LDDWLNELFD PFFDPEQSLA SADLSPDEQN  300
VESSNLGALA PKVEQDYSSP NENVVDDTEY LLPEDVYNIL HPGTDDFNML QNPLDQYHIQ  360
YATDVWSGIQ KEELWLPQAN AEPSQSNEAA DNGIIRRYRS MKTLEACVPQ CMGKTQAKMR  420
VGINKMATSS SESINQTIKF ENSGRLVEHQ KNQAHDVAST KRSDAGKPST ELSSNRGFLR  480
GIRNAFAGCS DARWNMTLVA VFAIGVAVVA LHVSQRLGLS QRDRQHT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-444420012172Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt and cold stresses. {ECO:0000269|PubMed:18813954}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281870.0AB028187.1 Oryza sativa mRNA for OsNAC8 protein, complete cds.
GenBankAK1028080.0AK102808.1 Oryza sativa Japonica Group cDNA clone:J033108J08, full insert sequence.
GenBankGU1203470.0GU120347.1 Oryza sativa Japonica Group clone KCS602B05 NAC8 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649784.10.0NAC domain-containing protein 74
SwissprotQ7GCL70.0NAC74_ORYSJ; NAC domain-containing protein 74
TrEMBLA0A0E0MU870.0A0A0E0MU87_ORYRU; Uncharacterized protein
STRINGORUFI01G11090.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75603847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.17e-66NAC domain containing protein 86
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]