PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G04670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 277aa    MW: 28543.2 Da    PI: 6.7631
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G04670.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.52.8e-44301291100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l++el
  ORUFI01G04670.1  30 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQKEL 123
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  ORUFI01G04670.1 124 DTAHAE 129
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.42729130IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4330127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MASSSSTSNS AISSVVASAV ATTTPGAGSP CAACKFLRRK CLPGCVFAPY FPPEEPQKFA  60
NVHKVFGASN VTKLLNELLP HQREDAVSSL AYEAEARVKD PVYGCVGAIS VLQRQVHRLQ  120
KELDTAHAEL LRYACGEVGI PTALPVTAAP RLAAAMPAPG QLAAAVSAGM YGGGRRLGVI  180
DGGGIAPPSP HTAGCYYARN NNAGSIGADV APVLPYASVA NWTVNAISTT TTNSGSESIG  240
MDHKEGGDSS ICGDLRFGLD ERGSERLQED GSPFIPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-83211492131LOB family transfactor Ramosa2.1
5ly0_B1e-83211492131LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2002380.0AB200238.1 Oryza sativa Japonica Group CRLL4 mRNA for LOB domain protein, complete cds.
GenBankAK1055270.0AK105527.1 Oryza sativa Japonica Group cDNA clone:001-127-G05, full insert sequence.
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648006.10.0protein LATERAL ORGAN BOUNDARIES
RefseqXP_025878847.10.0protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0E0MRW80.0A0A0E0MRW8_ORYRU; Uncharacterized protein
STRINGORUFI01G04670.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.47e-67LBD family protein