PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID gw1.9.674.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family HB-other
Protein Properties Length: 142aa    MW: 16612 Da    PI: 11.3764
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gw1.9.674.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox184.9e-06961282254
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   + p+++++e+LA++l+ + + V+++F N R++
  gw1.9.674.1  96 APFPDRAQKERLAEQLDWPVACVSNFFINARQR 128
                  688****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.64969132IPR001356Homeobox domain
SMARTSM003890.001770136IPR001356Homeobox domain
SuperFamilySSF466893.98E-1270133IPR009057Homeodomain-like
CDDcd000862.86E-572128No hitNo description
Gene3DG3DSA:1.10.10.607.4E-1575133IPR009057Homeodomain-like
PfamPF059206.4E-1189128IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
RLERAVDDVE RRFRAMRERM GWWNAGRDAE IATHAREGIR AVKERALDAA RAATRRATGR  60
LEASDANAPK EKKRRKLSSK AGQRMLRQWI LEHFDAPFPD RAQKERLAEQ LDWPVACVSN  120
FFINARQRFF KPLVLDLARE LE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16874PKEKKRR
27175KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP321077
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27220.23e-11BEL1-like homeodomain 5