PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID gw1.16.233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family HB-other
Protein Properties Length: 337aa    MW: 37388.7 Da    PI: 4.7666
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gw1.16.233.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-082743062254
                   SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   ++ p+++e+e LA+++gLt +qV  WF N Ra+
  gw1.16.233.1 274 KPIPTRAEKEALASQTGLTVTQVGDWFVNARAR 306
                   678*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.56246310IPR001356Homeobox domain
SuperFamilySSF466891.58E-11248314IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-19248313IPR009057Homeodomain-like
SMARTSM003896.0E-4248314IPR001356Homeobox domain
PfamPF059201.9E-10274306IPR008422Homeobox KN domain
CDDcd000869.25E-9277310No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
GLDLVLSVDD DASDASVFEA EGKREEDAGA WDDVLEAFDA YCERGFAGDG FDVDELLSEF  60
VIEPTAMGGG DDGDASAVAR STAARAIKKH IAHVLRDSTS VAESDDDERE MTRREAKDVP  120
TAIKYVRTRI NSKSNGKGYK PEMNRFAIMR DLFVADLRAF GERIREFEAL VEFMRPPADM  180
NIPEPRVVMQ KEFKKTLATI LNGFDDSFEH LTVVARRAKT SSAESSGTAT EASNDTREEQ  240
SNGGRGQGRH KRCARNVLAA WLWEHFYPTD ERLKPIPTRA EKEALASQTG LTVTQVGDWF  300
VNARARLWKP YIEGLIRGVY DDATVKKALD LQVNASA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001421834.12e-91predicted protein
TrEMBLA4S8X46e-90A4S8X4_OSTLU; Uncharacterized protein
STRINGABP001289e-91(Ostreococcus 'lucimarinus')
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP722266
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.16e-17BEL1-like homeodomain 11