PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID fgenesh1_pm.chr_17_#_137
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family HB-other
Protein Properties Length: 209aa    MW: 24008.9 Da    PI: 11.8985
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
fgenesh1_pm.chr_17_#_137genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.96e-121665857
                              -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                  Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                               ++   +L  +Fe +r p+a++r++LAk++g te+ V  WF  rR k+k+
  fgenesh1_pm.chr_17_#_137 16 DEDGAAILRGVFELERRPDAATRRRLAKQIGATEQAVNAWFRSRRVKMKR 65
                              5666789******************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.637666IPR001356Homeobox domain
SMARTSM003899.5E-6770IPR001356Homeobox domain
SuperFamilySSF466891.11E-111374IPR009057Homeodomain-like
PfamPF000461.7E-91665IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-112170IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MARMLDDARA RQTGVDEDGA AILRGVFELE RRPDAATRRR LAKQIGATEQ AVNAWFRSRR  60
VKMKRKRKRR MLLFVLLVLG TAAGAFYAWN AWHQTAAARR RMEALGQTYK WMTRSGLPRP  120
YPGKMNVERY GKKKLQVETE RVITASGREE ERPVRYTVDN PKSSPLTKKP ETPRQKLERL  180
RVEASKKKMK GRVAPMAQPN RVRESTST*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15868RRVKMKRKRKR
26369KRKRKRR
36370KRKRKRRM
46469RKRKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001422266.11e-97predicted protein
TrEMBLA4SA112e-96A4SA11_OSTLU; Uncharacterized protein
STRINGABP005834e-97(Ostreococcus 'lucimarinus')
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP929455