PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EuGene.0500010405
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family HB-other
Protein Properties Length: 308aa    MW: 33682.1 Da    PI: 10.7608
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EuGene.0500010405genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-09192241352
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        k+t++ ++ + +Le++++ ++yp+ ++ e + + ++L+ +++  WF+ rR
  EuGene.0500010405 192 KKTRLGSSNISTLEKVYAVTQYPDDAMVESIRQATRLPASKIIAWFKERR 241
                        678899999****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.896187247IPR001356Homeobox domain
SMARTSM003893.0E-5189251IPR001356Homeobox domain
SuperFamilySSF466892.31E-9189242IPR009057Homeodomain-like
CDDcd000861.46E-6192241No hitNo description
PfamPF000462.1E-7192241IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-9193242IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MTFASTPFAL ARASATPARA RASVGARAAG RAGTRRVATD ARARANARAR ASARVTTNAT  60
EGGESWEDLF DAFERQASEA EAEREIPRAK TRALERALAR GRRKVEVREL CKELELERHE  120
VIRWLKRNGH RAEELGRRYA EELANEDAER EARERAREAR AERAEAERQA AAEAKSRQGS  180
GPGGMPAYKT YKKTRLGSSN ISTLEKVYAV TQYPDDAMVE SIRQATRLPA SKIIAWFKER  240
RSGASAAAKG SAGVEDRSSR RSSGAAYSYT RRNEGGGLRR GGADDAYGDS NGPRRGRDAA  300
SDWSAYD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003079492.14e-83Homeobox domain
TrEMBLQ018M58e-82Q018M5_OSTTA; Homeobox domain
STRINGQ018M51e-82(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP710966
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.14e-07overexpressor of cationic peroxidase 3