PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G15860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 634aa    MW: 73166.1 Da    PI: 7.7512
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G15860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.82.2e-14381141494
                      T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      + +++p k ae+++g+ ++    +l+ +sg++W v +  +k  ++ +l +GW +F+ka++L+e+D + F+ +g+ ++++ +
  OPUNC12G15860.1  38 HSISIPEKVAERFSGQITK--GFRLKAPSGETWHVGV--EKIADELILMSGWGDFAKAHELQENDLLFFTCNGHGNGSCSF 114
                      458**********888555..59**************..*******************************77665554443 PP

2B341.81.9e-13251347198
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE.. CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefel 92 
                      f++vl  +  +++g+l++p  fa++h  +  +s ++ l+   + ++W vk+ yr +  r +  + W +F ++n+L+eg +++F+l++  ++ ++
  OPUNC12G15860.1 251 FVTVLQAPQIHRKGLLIVPSGFAADHLDN--RSHEILLMRpNKKEKWYVKY-YRASTTRGFNCQRWIKFIRENRLREGYICIFELMKGaRRVTM 341
                      788888999999**************545..44456666637779******.7666666555569*******************9977799999 PP

                      EEEEE- CS
               B3  93 vvkvfr 98 
                      +v+v+ 
  OPUNC12G15860.1 342 TVHVIG 347
                      999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-1724124IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.85725122IPR003340B3 DNA binding domain
CDDcd100172.69E-1427120No hitNo description
Gene3DG3DSA:2.40.330.101.9E-1628124IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.3E-628122IPR003340B3 DNA binding domain
PfamPF023621.4E-1138112IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-16244347IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-18244347IPR015300DNA-binding pseudobarrel domain
CDDcd100174.52E-14249346No hitNo description
PfamPF023626.2E-12251347IPR003340B3 DNA binding domain
SMARTSM010192.2E-10251349IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97251349IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-9385468IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-5386465IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-5524623IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-7524623IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.047582624IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MGEKGCESCR EWQEHYYREH MDVCRIRFFR LMTGDFGHSI SIPEKVAERF SGQITKGFRL  60
KAPSGETWHV GVEKIADELI LMSGWGDFAK AHELQENDLL FFTCNGHGNG SCSFDVLIFD  120
ASGCEKVSCF FTVKKNSIGG QNAEQYHLSD SEDTSTPSTF LVGSPHKAST SKKLNGKTKT  180
NPRKEPEGPN SSRSHVKREM IEEDKSDEDD EHAGDEHADY YYYSRFANYL TGEEREEIFS  240
LVSLQPGNPV FVTVLQAPQI HRKGLLIVPS GFAADHLDNR SHEILLMRPN KKEKWYVKYY  300
RASTTRGFNC QRWIKFIREN RLREGYICIF ELMKGARRVT MTVHVIGKVD DRFVLLGEEM  360
GEKECESCSK WQKHYYRDHI EVSRICFFRL MTGDFANRIS IPEKFAKDFN GHITKGLNLK  420
ASSCRTWRVG VEKAHELKEN DLLFFTCNGI GSCSFDVLIF HASGCEKVPS VFTEGKGPGN  480
VKKEMIEEEK SDDDDDKHVD YYYSRFANYL TCEEREEIFS LISLQPGNPV FVTVLRAGHV  540
HRKNILIKQK RETVCQILSC KHYQGLQLPS KRYVKYYHAN TTRGFNCHRW FKFISENRLR  600
EEYVCIFELM KGAKRPTMTV HAIGKIDDQF VLLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL8317970.0AL831797.4 Oryza sativa chromosome 12, . BAC OSJNBa0010M16 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619600.10.0B3 domain-containing protein Os12g0592300 isoform X2
SwissprotQ2QMT20.0Y1223_ORYSJ; B3 domain-containing protein Os12g0592300
TrEMBLA0A0E0MP670.0A0A0E0MP67_ORYPU; Uncharacterized protein
STRINGOPUNC12G15860.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56234179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-23B3 family protein