PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G15050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 722aa    MW: 80094.6 Da    PI: 4.9925
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G15050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.75.1e-1113427141374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts   +++ l+a++l+  +  + k+s
  OPUNC12G15050.1 342 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLMAKRTS---VVDILQAYQLYMAAICFKKVS 432
                      6789***************************************************999999999999998...********************* PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++RiTg++ p++g   +e++eetg+rL+k+A+e++vpf++n+++a ++
  OPUNC12G15050.1 433 FIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRITGIDIPQPGfrPTERIEETGRRLSKYAQEFQVPFKYNAIAAAKM 526
                      **********************************************************9******************************999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+ prese
  OPUNC12G15050.1 527 ESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDATTPRESE 620
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +r  +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++S W+
  OPUNC12G15050.1 621 QRLLIEQNIFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQIVRNKVKDCYHKDFVIDIDHQWLLQGWKGRILYAISTWT 714
                      *****************************************************************889*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.844316694IPR005202Transcription factor GRAS
PfamPF035141.8E-108342714IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MGSSAADSFP AGDPYGIGGG EEEDDPSLFL YLSDLAPVSP SAYLDLPPSP PPPTTTTTMK  60
QAGEEAPEDL VLPFISRMLM EEDIDDKFFY DYPDNPALIQ AQQPFLDILS EPSSNSLSNS  120
DDLRLSPTSS TDTSAAINSY EATAPAAVPQ YESIELDPAA FFAAANSDLM SSAFLKGMEE  180
ANKFLPTENK LVIDLEASSE NNYLRGVEEA KRFLPSDDKL QVGFAAPANA AAAPVVSVKK  240
EAVDVVVTSG GRGRKNPYND EELELEGGRS SKQTAVQGDD VAARAMFDKV MMPSHENCTE  300
MMEKLRIAMK EEAAKNEASA GGKGGNGKVK GGRRGGRDVV DLRTLLIHCA QAVATDDRRS  360
ATELLKQIKQ HAKPTGDATQ RLAHCFAEGL QARIAGTGSL VHQSLMAKRT SVVDILQAYQ  420
LYMAAICFKK VSFIFSNQTI YNASLGKKKI HIVDYGIQYG FQWPCFLRRI SQREGGPPEV  480
RITGIDIPQP GFRPTERIEE TGRRLSKYAQ EFQVPFKYNA IAAAKMESVR KEDLNIDPDE  540
VLIVNCQYQF KNLMDESVVI DSPRDIVLSN IRKMQPHVFI HAIVNGSFSA PFFVTRFREA  600
LFFYSALFDV LDATTPRESE QRLLIEQNIF GRAALNVIAC EGTDRVERPE TYKQWQVRNQ  660
RAGFKQLPLN PEIVQIVRNK VKDCYHKDFV IDIDHQWLLQ GWKGRILYAI STWTPNDAIS  720
YF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-433467138374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1219430.0AK121943.1 Oryza sativa Japonica Group cDNA clone:J033107F03, full insert sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0E0MNV80.0A0A0E0MNV8_ORYPU; Uncharacterized protein
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-163GRAS family protein