PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G00190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 200aa    MW: 22138 Da    PI: 8.6547
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G00190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.1e-21666257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     ++R+++t+eql +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  OPUNC12G00190.1  6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66
                     58*****************99**************************************97 PP

2Wus_type_Homeobox121.73e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
    OPUNC12G00190.1  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67
                       689***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.463267IPR001356Homeobox domain
SMARTSM003896.8E-6471IPR001356Homeobox domain
CDDcd000869.17E-4560No hitNo description
PfamPF000461.1E-18666IPR001356Homeobox domain
SuperFamilySSF466899.41E-12767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-8866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KARERQRLRR RLCARHQQQQ QPSPPSSTVP PAPTAAGAVV QVHPAVMQLH HHHHHHPYAA  120
AAAAQSNCSF MQQQQQAEWP AVDYCSIASA SASATADMAI PPCCRPLKTL ELFPTKSTSG  180
GLKEDCCSSS KSSSCSTSTN
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. Seems to act as repressor of YAB5. {ECO:0000269|PubMed:17351053}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2188930.0AB218893.1 Oryza sativa Japonica Group mRNA for OsWOX3 protein, complete cds.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0004960.0BX000496.1 Oryza sativa chromosome 12, . BAC OSJNBa0096E03 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0005030.0BX000503.2 Oryza sativa chromosome 12, . BAC OSJNBb0077A02 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0725480.0BX072548.4 Oryza sativa chromosome 11, . BAC OSJNBa0029D01 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616762.18e-66WUSCHEL-related homeobox 3
RefseqXP_015619606.18e-66WUSCHEL-related homeobox 3
SwissprotA2ZH477e-67WOX3_ORYSI; WUSCHEL-related homeobox 3
SwissprotQ33DK17e-67WOX3_ORYSJ; WUSCHEL-related homeobox 3
TrEMBLA0A0E0MIK81e-146A0A0E0MIK8_ORYPU; Uncharacterized protein
STRINGOPUNC12G00190.11e-147(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-35WOX family protein
Publications ? help Back to Top
  1. Jiang G, et al.
    Regulation of inflorescence branch development in rice through a novel pathway involving the pentatricopeptide repeat protein sped1-D.
    Genetics, 2014. 197(4): p. 1395-407
    [PMID:24950892]
  2. Cheng S,Huang Y,Zhu N,Zhao Y
    The rice WUSCHEL-related homeobox genes are involved in reproductive organ development, hormone signaling and abiotic stress response.
    Gene, 2014. 549(2): p. 266-74
    [PMID:25106855]
  3. Niu L, et al.
    LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula.
    Plant J., 2015. 81(3): p. 480-92
    [PMID:25492397]
  4. Angeles-Shim RB, et al.
    A WUSCHEL-related homeobox 3B gene, depilous (dep), confers glabrousness of rice leaves and glumes.
    Rice (N Y), 2012. 5(1): p. 28
    [PMID:27234246]