PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G20020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 584aa    MW: 66031.4 Da    PI: 6.2777
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G20020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS294.92.1e-902075762373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lL+ cA+a+++++++ a +lL++++++a  +gd+mqR+a+yf+ +L+arla+s+++ly+  + ++ s    +e l+++kl+  ++ + k++ 
  OPUNC11G20020.1 207 RMLLILCAQAMATDNQQSAGELLKKIQQHALATGDAMQRVAHYFAMGLEARLAGSGKHLYQ--NRWRMS---LVEYLKVYKLYMAACCFKKVAL 295
                      679*********************************************************5..445554...99******************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + a  +I++av+g++r+Hi+D+++  Gl+Wp L++ L sR++gpp++RiT v+ p++g   ++++e+ g+ L++ A+e++vpf+f++++a ++e
  OPUNC11G20020.1 296 IFAAMTIMQAVQGKKRLHIVDYGARCGLHWPDLFRRLGSREDGPPEVRITIVDIPQPGfrPSQSIEAAGHCLSSCANEFRVPFRFHAVAAAKWE 389
                      *********************************************************9*9***************************9999*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++ +e+L+++ +E+l+Vn  ++   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf  al yysalfd+l+a+ pres
  OPUNC11G20020.1 390 TVGVEDLHIELDEVLVVNDLFSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGITNENY-GASFLSRFRGALLYYSALFDMLDATTPRES 482
                      ******************************98776669************************9.789*************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      e r  +E+ +lg+ + n++acega+ ++r e++++W++r ++aG+++++l+ +++++++  +++++ + + +ee+ +++++gW++r L++ SaW
  OPUNC11G20020.1 483 ELRLALEQNVLGPYALNAIACEGADLVQRPEKYRQWQARNHRAGMQQLTLRPDIVDTIRDEVNRYHHKDFLLEEDGQWMLQGWMGRILFAHSAW 576
                      ******************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.243180557IPR005202Transcription factor GRAS
PfamPF035147.3E-88207576IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENQAPS PPPVFFDLPP TPIANSDDNQ LLSYISRMLM EDEMGSSDAT  60
TNLQCGSTEE AKDLLPGSEV VRAFLKGMEE ASKFLPRNNR FGMLETVDQV SRQISHGHCR  120
GRKKRNHDRD EQQLEEELGR SSKLAALRIA GPEEAGAREL LDELMLHAHE TCIKDMEKLR  180
IDMDNEAAKN INKKDKKGSS RKAVDLRMLL ILCAQAMATD NQQSAGELLK KIQQHALATG  240
DAMQRVAHYF AMGLEARLAG SGKHLYQNRW RMSLVEYLKV YKLYMAACCF KKVALIFAAM  300
TIMQAVQGKK RLHIVDYGAR CGLHWPDLFR RLGSREDGPP EVRITIVDIP QPGFRPSQSI  360
EAAGHCLSSC ANEFRVPFRF HAVAAAKWET VGVEDLHIEL DEVLVVNDLF SFSALMDESV  420
FCDGPNPRDV ALRNISKMQP DVFIQGITNE NYGASFLSRF RGALLYYSAL FDMLDATTPR  480
ESELRLALEQ NVLGPYALNA IACEGADLVQ RPEKYRQWQA RNHRAGMQQL TLRPDIVDTI  540
RDEVNRYHHK DFLLEEDGQW MLQGWMGRIL FAHSAWVPQD TSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-292105768374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616386.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0MIE50.0A0A0E0MIE5_ORYPU; Uncharacterized protein
STRINGORGLA11G0190500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-123SCARECROW-like 14