PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G20010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 1883aa    MW: 211821 Da    PI: 5.5844
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G20010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS349.94.2e-1073036811374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av++gd + a++lL+++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   +++ l+a+klf  ++ i k+ 
  OPUNC11G20010.1 303 LRTLLIHCAQAVATGDRRSATELLKQVKQNSSPRGDATQRLACCFAEGLEARLAGTGSQVYQSLVAKRTS---TVDFLKAYKLFTAACCIKKVN 393
                      6789************************************************************999999...8******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                       +  N++I +av+g++++Hi+D+++ +G+QWp L++ L++R++gpp++RiTg++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a ++
  OPUNC11G20010.1 394 VIFSNKTICDAVAGKRKLHIVDYGLCYGFQWPGLFKFLSEREGGPPEVRITGIDLPQPGfrPAQQIEETGRRLSNCARQFGVPFKFQA-IAAKW 486
                      **********************************************************9*****************************.799** PP

             GRAS 187 edleleeLrvkp.....gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                      e+++ e+L+++      +E+l+Vn+ + l  l desv ++s  +rd vL+ +++++P v++ +  +  ++++ F++rf eal +ysa fd+l+a
  OPUNC11G20010.1 487 ETVRREDLHLDVdseeeEEVLVVNCLHGLNALQDESVVVDSpsPRDMVLNNIRDMRPVVFIQCVVNGAYGAPFFVTRFREALFHYSAQFDMLDA 580
                      ********8877678889******************98888779************************************************** PP

             GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                      ++pr+++er  +Er llgr++ nv+acega+r+ r et+++W+ r ++aG++++pl+ ++++ +++ +++ + + + ++ ++++l++gWk+r L
  OPUNC11G20010.1 581 TIPRDNDERLLIERDLLGRWALNVIACEGADRVDRPETYKQWQVRNHRAGLTQLPLEPQVVELVRHKVKNLYHKDFVIDVDHNWLLQGWKGRIL 674
                      ************************************************************************888******************* PP

             GRAS 368 vsvSaWr 374
                      +++SaW+
  OPUNC11G20010.1 675 YAMSAWE 681
                      ******5 PP

2GRAS342.38.1e-10593513012373
             GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93  
                        +lL++cA+av++gd + a++lL+++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   +++ l+a+klf  ++ + k+
  OPUNC11G20010.1  935 HTLLIHCAQAVATGDRRSATQLLNQIKQHSSPRGDATQRLACCFAEGLEARLAGTGSQVYQSLMAKRTS---TVDFLKAYKLFTAACCVNKV 1023
                       679************************************************************999998...8******************* PP

             GRAS   94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183 
                         +  N++I +av+g +++Hi+D+++++G+QWpaL+  L +R++gpp++R+Tg++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a
  OPUNC11G20010.1 1024 NIIFSNKTIHNAVAGRHKLHIVDYGLGYGFQWPALFLLLGAREGGPPEVRMTGIDVPQPGfrPADQIEETGRRLSNWARQFGVPFKFQA-IA 1114
                       ***********************************************************9*****************************.79 PP

             GRAS  184 krledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273 
                        ++e+++ e+L  +v+p+E+l+Vn+ + l +l       es+rd vL+ +++++P+v+v +  +  ++++ F++rf eal +ysa fd+l+a
  OPUNC11G20010.1 1115 AKWETVRREDLglDVDPEEVLVVNCLHGLNNLQ-----EESPRDMVLNNIRDMRPDVFVQCVVNGAYGAPFFVTRFREALFHYSAQFDMLDA 1201
                       9********98556778************9997.....6778999*********************************************** PP

             GRAS  274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365 
                       ++pr+++er  +Er llgr++ nv+acega+r+ r et+++W+ r ++aG++++pl+ ++++ +++ ++  + + + ++ ++++l++gWk+r
  OPUNC11G20010.1 1202 TIPRDNDERLLIERDLLGRWALNVIACEGADRVDRPETYKQWQVRNHRAGLTQLPLEPQVVELVRHKVKSLYHKDFVIDVDHNWLLQGWKGR 1293
                       ************************************************************************888***************** PP

             GRAS  366 pLvsvSaW 373 
                        L+++SaW
  OPUNC11G20010.1 1294 ILYAMSAW 1301
                       ******** PP

3GRAS349.84.3e-107150718782373
             GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93  
                        +lLl+cA+av+++d + a++lL ++++++sp gd+ qRla++f+++L+arla+++s++y++l +++ts   +++ l+a++l+ e++ + k+
  OPUNC11G20010.1 1507 HNLLLHCAQAVATDDRRSAHELLRQIKQHSSPWGDAGQRLAHCFAQGLEARLAGTGSQVYRSLMSQRTS---VVDFLKAYRLYMEACCCKKV 1595
                       689************************************************************999999...******************** PP

             GRAS   94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183 
                       +++  N++I++av+g +r+Hi+D+++s+G+QWp Ll++La+R++gpp++RiTg++ p++g    + +eetg+rL+k+A+elgvpf+f+ ++a
  OPUNC11G20010.1 1596 AFVFSNKTIYDAVAGRSRLHIVDYGLSYGFQWPGLLRELAARRGGPPEVRITGIDLPQPGfrPDQHIEETGRRLSKYADELGVPFKFQGIAA 1687
                       ***********************************************************9*99***************************99 PP

             GRAS  184 krledleleeLrvkpgEalaVnlvlqlhrlldesv.sleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274 
                       +r e+++leeL+ + +E+++V +  +  +++des+ + +s+rdevL+ +++++P+v+++   +a ++++ Fl+rf eal+yy+a fd l+a+
  OPUNC11G20010.1 1688 TRKESVRLEELEGEADEVVVVISLCHFRSVMDESLlDRRSPRDEVLSNIRRMRPDVFIHGIMNAAYGATYFLTRFREALYYYAAQFDLLDAT 1779
                       9******************************999725556**************************************************** PP

             GRAS  275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366 
                       ++r+s+er+ vEr ++gr++ nv+acegaer+er e +++W++r ++aG++++pl+ +++  +   +r  + + + v+e++ +l+  Wk+r 
  OPUNC11G20010.1 1780 VARDSHERMLVERDIFGRAALNVIACEGAERVERPEMYKQWQARNQRAGLRQLPLNPQVVRLVLDKVRDKYHKDFVVDEDQRWLLHRWKGRV 1871
                       *****************************************************************999999888****************** PP

             GRAS  367 LvsvSaW 373 
                       L+++S W
  OPUNC11G20010.1 1872 LYALSTW 1878
                       ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.429277661IPR005202Transcription factor GRAS
PfamPF035141.4E-104303681IPR005202Transcription factor GRAS
PROSITE profilePS5098560.1859081282IPR005202Transcription factor GRAS
PfamPF035142.8E-1029351301IPR005202Transcription factor GRAS
PROSITE profilePS5098561.21914801859IPR005202Transcription factor GRAS
PfamPF035141.5E-10415071878IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 1883 aa     Download sequence    Send to blast
MVWDGSIGLK ESMAAAAAPQ LEEPVVVEVE PFSPSLFLDL PPTPHDDDPN DDDLLLPFIS  60
RMLMEDDIDD KFFYQFPDHP ALLNAQQPYA QILEAPSDDT ITNTTNSSDD SASAATTTWP  120
YDPIELSQLL QSPPHPVFDT LDGGATKSAP DEDADLFAGA DNMEMLNMAF LKGREEANKF  180
LPTNNTLFAA FDSDARLKAE PVLDDPTLMF GGSGGRGRKN RHCEEDDLEA ETGRSSKLMV  240
PPQEDTAAAR EMLDEIMFNG YEVIMKGMDE LRVAMDSEAE KKARNGGGAG RRADRAKAAV  300
VDLRTLLIHC AQAVATGDRR SATELLKQVK QNSSPRGDAT QRLACCFAEG LEARLAGTGS  360
QVYQSLVAKR TSTVDFLKAY KLFTAACCIK KVNVIFSNKT ICDAVAGKRK LHIVDYGLCY  420
GFQWPGLFKF LSEREGGPPE VRITGIDLPQ PGFRPAQQIE ETGRRLSNCA RQFGVPFKFQ  480
AIAAKWETVR REDLHLDVDS EEEEEVLVVN CLHGLNALQD ESVVVDSPSP RDMVLNNIRD  540
MRPVVFIQCV VNGAYGAPFF VTRFREALFH YSAQFDMLDA TIPRDNDERL LIERDLLGRW  600
ALNVIACEGA DRVDRPETYK QWQVRNHRAG LTQLPLEPQV VELVRHKVKN LYHKDFVIDV  660
DHNWLLQGWK GRILYAMSAW EAMAASPKLE VEPFSPSLFL DLPPTPTPHD DDHNNDDLLL  720
PFISRMLMED DIHDKFFYHF PDHPALLHTQ QSYAQILHAP SSSSDDTTNN NTSNSSVPDH  780
DGYGGATQSA PDLKQLFARA HNMEMLNMAF LKGREEAIKF LPTNKTLFAG FDGAARLKEE  840
PTFMFIRSGG RGRKNKHGEE DDLDAETSRS SKLMVPEHED TAEAGKIFDE IILNGYQMII  900
KGIDDLRVSM GSEADEKARN GLRASRAKTA VVDLHTLLIH CAQAVATGDR RSATQLLNQI  960
KQHSSPRGDA TQRLACCFAE GLEARLAGTG SQVYQSLMAK RTSTVDFLKA YKLFTAACCV  1020
NKVNIIFSNK TIHNAVAGRH KLHIVDYGLG YGFQWPALFL LLGAREGGPP EVRMTGIDVP  1080
QPGFRPADQI EETGRRLSNW ARQFGVPFKF QAIAAKWETV RREDLGLDVD PEEVLVVNCL  1140
HGLNNLQEES PRDMVLNNIR DMRPDVFVQC VVNGAYGAPF FVTRFREALF HYSAQFDMLD  1200
ATIPRDNDER LLIERDLLGR WALNVIACEG ADRVDRPETY KQWQVRNHRA GLTQLPLEPQ  1260
VVELVRHKVK SLYHKDFVID VDHNWLLQGW KGRILYAMSA WDALFDDDMV LPYISRLLME  1320
DDVDDHFFYQ YPDHPALLHA QQPFAQILDD EAATAAFPTA AVHFDAAGDK QGSLDMVNMA  1380
FLKGMEEANK FLPTNTSSLI LLSSSTLQLQ GEVVVDGAIN SKKVNCRDDD LEVTRATKLM  1440
APEPELEEEG AREMFDEMML QEHEICMKGV KQLSLSVGTA SENKSKSSSK KPRGRRTVIH  1500
TEPVDLHNLL LHCAQAVATD DRRSAHELLR QIKQHSSPWG DAGQRLAHCF AQGLEARLAG  1560
TGSQVYRSLM SQRTSVVDFL KAYRLYMEAC CCKKVAFVFS NKTIYDAVAG RSRLHIVDYG  1620
LSYGFQWPGL LRELAARRGG PPEVRITGID LPQPGFRPDQ HIEETGRRLS KYADELGVPF  1680
KFQGIAATRK ESVRLEELEG EADEVVVVIS LCHFRSVMDE SLLDRRSPRD EVLSNIRRMR  1740
PDVFIHGIMN AAYGATYFLT RFREALYYYA AQFDLLDATV ARDSHERMLV ERDIFGRAAL  1800
NVIACEGAER VERPEMYKQW QARNQRAGLR QLPLNPQVVR LVLDKVRDKY HKDFVVDEDQ  1860
RWLLHRWKGR VLYALSTWVA QHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3930718788374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0MIE40.0A0A0E0MIE4_ORYPU; Uncharacterized protein
STRINGBGIOSGA035741-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-142GRAS family protein