PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G05830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 435aa    MW: 49207.6 Da    PI: 9.0222
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G05830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3598.6e-1952142199
                      EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                      ff vl      ++ r+ +p +f  ++ +++ + + +++l d+sg++W+ +l  +  s+++++  GWkeFvk+n ++ g f+vF++d++s+f   
  OPUNC11G05830.1  52 FFRVL--LTLESLERMKIPSSFN-QYfQNQ-PLG-MVSLVDRSGNTWSAEL--TSDSEGFFFVHGWKEFVKDNSIQCGQFLVFTYDKQSQF--S 136
                      55666..344556789******8.662555.555.9***************..********************************998999..9 PP

                      EEEE-S CS
               B3  94 vkvfrk 99 
                      v+vf+ 
  OPUNC11G05830.1 137 VTVFDP 142
                      999885 PP

2B347.43.4e-15317408398
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      ++++ s+v+    + +p +f++e+   +++sk +tl d++g  Wev++ y   ++   +++GW +F+  n+L+  D++vF+l++  + + +v +
  OPUNC11G05830.1 317 QIMMESYVHVGFFMNMPCEFVRECL--PRTSKRITLWDPQGMAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVE--QDNIKVYI 406
                      679999******************6..457889***************995555556799*********************986..44457777 PP

                      E- CS
               B3  97 fr 98 
                      +r
  OPUNC11G05830.1 407 YR 408
                      65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086314.63550143IPR003340B3 DNA binding domain
CDDcd100172.85E-1850141No hitNo description
SuperFamilySSF1019363.79E-2251147IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-2051143IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.5E-1552143IPR003340B3 DNA binding domain
PfamPF023627.9E-1754141IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.1E-24307408IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.62E-24308408IPR015300DNA-binding pseudobarrel domain
CDDcd100173.30E-22313408No hitNo description
PROSITE profilePS5086312.915315410IPR003340B3 DNA binding domain
SMARTSM010193.9E-12315410IPR003340B3 DNA binding domain
PfamPF023623.4E-13317408IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MGRRKNREAG RSRREEEEEE ERAVMVVGAE QGGRMEKGKA KEGDMSCFGR SFFRVLLTLE  60
SLERMKIPSS FNQYFQNQPL GMVSLVDRSG NTWSAELTSD SEGFFFVHGW KEFVKDNSIQ  120
CGQFLVFTYD KQSQFSVTVF DPSGIDKISA FSSHPSKNVI IKTESDEGGM VTAAITTEKM  180
APAKEYNGIT GKRTRDVDCL MKDRVVCKKS SEANDCENSR RKRAGVTASK SKATSTSYNS  240
TRGSSCSMSD EDNSSSQPPR QPLLMRLLSG EVSRRGISKG QRQLTVISQR RSVTEAEKDH  300
ALQKAGEFKS KNPFAVQIMM ESYVHVGFFM NMPCEFVREC LPRTSKRITL WDPQGMAWEV  360
NYVYYSDRSV GSFSGGWGKF AVGNNLEKFD VCVFELVEQD NIKVYIYRVI PEITPHRLRS  420
DPKLSSKYTG LRFEN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019410.0AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0E0MDJ20.0A0A0E0MDJ2_ORYPU; Uncharacterized protein
STRINGOPUNC11G05830.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.14e-18B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]