PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G05820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 361aa    MW: 40605.1 Da    PI: 9.8594
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G05820.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.52.1e-174791899
                     --HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3 18 lpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                     +p +f  ++ ++++++  +++l d+sg++W+ +l  +  s+++++  GWkeFvk+n ++ g f+vF++d+rs+f   v+vf+ 
  OPUNC11G05820.1  4 IPSSFN-QClQNQPTG--MVSLVDRSGNTWSAEL--TSDSEGFFFVHGWKEFVKDNSIQCGQFLVFTYDKRSQF--SVTVFDP 79
                     888887.554666655..8***************..*********************************99999..9999885 PP

2B353.25.3e-17255346398
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      ++++ s+v     + +p +f++e+   +++sk +tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l+++++   +v++
  OPUNC11G05820.1 255 QIMMESYVYVGFFMNIPCEFVRECL--PRTSKRITLWDPQGKAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDN--IKVHI 344
                      6789999999**************6..457889***************995555556799*********************998444..57887 PP

                      E- CS
               B3  97 fr 98 
                      +r
  OPUNC11G05820.1 345 YR 346
                      76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086315.425180IPR003340B3 DNA binding domain
SMARTSM010194.3E-6180IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.1E-19380IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-20384IPR015300DNA-binding pseudobarrel domain
CDDcd100171.69E-15478No hitNo description
PfamPF023623.8E-15478IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-26245346IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-26246346IPR015300DNA-binding pseudobarrel domain
CDDcd100178.69E-25251346No hitNo description
SMARTSM010194.3E-15253348IPR003340B3 DNA binding domain
PROSITE profilePS5086313.437253348IPR003340B3 DNA binding domain
PfamPF023623.3E-15255346IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MQKIPSSFNQ CLQNQPTGMV SLVDRSGNTW SAELTSDSEG FFFVHGWKEF VKDNSIQCGQ  60
FLVFTYDKRS QFSVTVFDPS GIDKISTFSS HPSKNVIIKT ESDEGGMVTA AITTEKMAPA  120
LKENNGITGK RTRDVLMEGR VVFKKSSEAN VCESSRRKRA GVTAGKSKAT STSHNSTRGS  180
SCSMSDEDNS SSQSPRPPLL MRFLSGEVSR RGKCISKGQR QLTVISQRRP VTEAEKDHAL  240
QRAREFKSKN PFAVQIMMES YVYVGFFMNI PCEFVRECLP RTSKRITLWD PQGKAWEVNY  300
VYYSDRSVGS FSGGWGKFAV GNNLEKFDVC VFELVQKDNI KVHIYRVIPE ITPHRLRSDL  360
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A9e-1422634722142B3 domain-containing transcription factor VRN1
4i1k_B9e-1422634722142B3 domain-containing transcription factor VRN1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019410.0AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0E0MDJ10.0A0A0E0MDJ1_ORYPU; Uncharacterized protein
STRINGOPUNC11G05820.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.12e-17B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]