PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC10G16890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 333aa    MW: 37055.4 Da    PI: 4.9726
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC10G16890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-13110154347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  OPUNC10G16890.1 110 PWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 154
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.455102159IPR017930Myb domain
SMARTSM007171.1E-9107157IPR001005SANT/Myb domain
SuperFamilySSF466893.89E-16108160IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-19108158IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.8E-11109153IPR009057Homeodomain-like
PfamPF002495.1E-11110154IPR001005SANT/Myb domain
CDDcd001676.29E-9110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAGTPGRREL GLRTAAESAR RQDQDASSGV SDLGLWKMDL GNDVYQWLSE GEVYEFDSGN  60
CCNGTFGICQ ICQYGMATLA CRYMLVSCKG YFVQLHQQNY RHQDLEVGVP WTEEEHRRFL  120
LGLQKLGKGD WRGISRNFVV SRTPTQVASH AQKYFIRQSN MTRRKRRSSL FDMVPDESMD  180
LPPLPGGQEP ETQVLNQPAL PPPREEEEVD SMESDTSAVA ESSSASAIVP ENLQSTYPVI  240
VPAYFSPFLQ FSVPFWQNQK DEDGPVPETH EIVKPVPVHS KSPINVDELV GMSKLSIGDS  300
NQETVSTSLS LNLVGGQNRQ SAFHANPPTR AQA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8372540.0EU837254.1 Oryza sativa Japonica Group clone KCS344D12 myb transcription factor mRNA, complete cds.
GenBankAK1010620.0AK101062.1 Oryza sativa Japonica Group cDNA clone:J033022I10, full insert sequence.
GenBankAK0669610.0AK066961.1 Oryza sativa Japonica Group cDNA clone:J013093O16, full insert sequence.
GenBankAK0597160.0AK059716.1 Oryza sativa Japonica Group cDNA clone:001-032-G03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614288.11e-154PREDICTED: transcription factor MYB1R1
TrEMBLA0A0E0MAQ80.0A0A0E0MAQ8_ORYPU; Uncharacterized protein
STRINGLOC_Os10g41200.11e-153(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-68MYB_related family protein