PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC09G15210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 386aa    MW: 39514 Da    PI: 4.7481
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC09G15210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP99.65.6e-31119196583
              TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                        r+ ++h kv+gR+RR+R++++caar+ +L++eLG+++d++ti WL+qq++pai ++tgt++ +a ++ +++ +    
  OPUNC09G15210.1 119 PPRNRDRHVKVEGRGRRIRMPVNCAARIAKLTRELGHKSDGETIRWLMQQSEPAILAATGTGTVPAIAT-TVDGVLRIP 196
                      5799*********************************************************88888443.333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136924.168122176IPR017887Transcription factor TCP subgroup
PfamPF036343.7E-25122201IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MASQLQGKAA EAATGERAQA EVPPGNAAAF AGLGYPAPVQ SPLALQEEAP GDSAFSGYAP  60
IRSPVVSRVQ EKGEEEEADK RDETGMAADG TFAAGMSLVP KPEPVAVEFL RGLAVAKPPP  120
RNRDRHVKVE GRGRRIRMPV NCAARIAKLT RELGHKSDGE TIRWLMQQSE PAILAATGTG  180
TVPAIATTVD GVLRIPTESP SAVVAASRGD EPTPKRRRKL QPTRAAAGGA VEPLATVPPP  240
AVYYSIVADP LLQANGGGSI SVSSGLAPVS SATAPAAGGG AIPFIAIPAA SDGGKQVMSP  300
ATVWMVPPGG AGAVNQPMQY WSFQPNPDHA NFTGSSNSQH QPFYNVGQNP GDQEASAADQ  360
AAAAGGGGGG EEDEYEGMTD SSSEEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061750.0AP006175.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0669G04.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612634.11e-179transcription factor PCF2-like
SwissprotA2YXQ13e-83PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH63e-83PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A0E0M3J20.0A0A0E0M3J2_ORYPU; Uncharacterized protein
STRINGOPUNC09G15210.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-42TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]