PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC09G07830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 361aa    MW: 37031.7 Da    PI: 7.5467
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC09G07830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32161214255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OPUNC09G07830.1 161 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 214
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.74E-15158215IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-29159215IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-24161214IPR006447Myb domain, plants
PfamPF002496.1E-7162213IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEASSAATPD LSLHISLPSS AAAAAAATGT SGGGRGGGPS PAGGDGHHHH HPKMGFYSSY  60
HHPATWPSTS PSPLAAPPGD PTAAFLSSPH HRMLSAASGR LNGMLSDTLR SYGGGGGGAI  120
PGVIGGAHHH HHHHHLHGGQ PFGLASRFMP KLPAKRSMRA PRMRWTSTLH ARFVHAVELL  180
GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKSTDK PAASSGPADG GSGDEEFAGG  240
GQAASGGGDS MCLRGGGAVA AFAEHGRSAS EGAASSVGGG DMDQSSAGNT STTRWSNSSR  300
DPWLSSNSCN MDAHRSVGLS SPIENLEPCR SSSSQVSNHE LSSPSLEFTL GRPDWHGADH  360
D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-16162216357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16162216357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16162216357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16162216357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ2687480.0FJ268748.1 Oryza sativa Japonica Group rolled leaf 9 (RL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610960.11e-172probable transcription factor RL9
SwissprotQ0J2351e-172ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0E0M0W10.0A0A0E0M0W1_ORYPU; Uncharacterized protein
STRINGOPUNC09G07830.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-43G2-like family protein