PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G09920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 712aa    MW: 80695.8 Da    PI: 8.7789
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G09920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3438.1e-144345121694
                      EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EE CS
               B3  16 lvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvv 94 
                      l +pk++a++h  +  es+ +tl+   ++++W  +l++++ ++ y+l++ W +Fv +n++ egD+++F+ ++  + f ++v
  OPUNC08G09920.1 434 LEIPKEYAAAHFPN--ESVAITLQMlGKNKKWHPRLCMENDKRIYMLRGHWLDFVLDNHVMEGDICLFEPMKGgKIFVFTV 512
                      78*********855..6778888885577****************************************775446665555 PP

2B350.44.1e-166247081097
                      HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + k ++l l+ +++++h   + +s++++  +  g++We k+i++++  r +lt+GW +F+ +n+L++gD+++F+l+++++ ++ v+++
  OPUNC08G09920.1 624 SRKYCMLELSSRYVARHF--PGTSQDVV-LHCMGNTWETKMIVSGNLTRWFLTGGWTKFACDNRLRAGDICLFELKEERRLTMAVHII 708
                      4566999999***99995..33455677.5569******************************************9989999998885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.16E-51283IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-12203315IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-12204304IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.02210308IPR003340B3 DNA binding domain
SMARTSM010196.0E-5210308IPR003340B3 DNA binding domain
CDDcd100176.91E-10210287No hitNo description
PfamPF023622.8E-7214307IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-20410517IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.83E-18411517IPR015300DNA-binding pseudobarrel domain
CDDcd100172.63E-17416513No hitNo description
SMARTSM010191.3E-4418518IPR003340B3 DNA binding domain
PROSITE profilePS5086311.744419518IPR003340B3 DNA binding domain
PfamPF023623.3E-12433513IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.7E-20605708IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-18607707IPR015300DNA-binding pseudobarrel domain
CDDcd100171.99E-18609708No hitNo description
SMARTSM010196.8E-10610712IPR003340B3 DNA binding domain
PROSITE profilePS5086311.42615711IPR003340B3 DNA binding domain
PfamPF023621.1E-13624708IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MSKPCECCHT KMKFIWQMNG NFKHSMIIPD RFLSHFAAKS SGTITLETPN ENSPFWMGGE  60
NDFLSFRYRG SSRFAVTVFD ASGLEKVYFC CAAAGMKNAS NNVQKKARTY IDISSSSDDH  120
TTQSSASDTS DECQKARSIH HGKQAKKPSV SSSEDLSAKD GSSGYRSLES ENLDRFSSLY  180
YLPGHHKLTE EQKVELVALV DKIQPEICVL VIIMNKTNVK RHPDLVVPKD YALLHFPHKN  240
QIITLELPGK KNWACKFRIR ADGGGRHLYL GDFVHNNHIL EGDLCIFQPM TKHNASVFSI  300
TVHLIRKERT DIASSHQTRR INSGGISSSS HDDTTRYNQG DKRFARRDSS SHIRKITKMA  360
HEESGEGSPD ENDSFKSDDL QTLPITDYVL SYKSYLSGAQ TEQVIMLLRE IRPKKPVLVA  420
VMRKKNVQWS SPFLEIPKEY AAAHFPNESV AITLQMLGKN KKWHPRLCME NDKRIYMLRG  480
HWLDFVLDNH VMEGDICLFE PMKGGKIFVF TVHLLCATPT DRSGGISVQM ASSSHGRTNP  540
KMASGVRIKE EPTDGNGSSE NKKHGASNES LQNRNSNDSP YILPHRSHLS PFQEKDVLEK  600
IEAIQYEVPI CVAIMKDYNV DYSSRKYCML ELSSRYVARH FPGTSQDVVL HCMGNTWETK  660
MIVSGNLTRW FLTGGWTKFA CDNRLRAGDI CLFELKEERR LTMAVHIIFS KQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2370911e-172AC237091.1 Oryza glaberrima clone OG_BBa0009K13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0LTT00.0A0A0E0LTT0_ORYPU; Uncharacterized protein
STRINGOPUNC08G09920.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.17e-12B3 family protein