PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G07010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 398aa    MW: 42809.6 Da    PI: 9.0514
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G07010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.82.4e-153797257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     r+R+++++eq+ +Le+ F++   +p ++e +++ + l     + +++V++WFqNrR + ++
  OPUNC08G07010.1 37 RSRWAPKPEQILILESIFNSgMVNPAKDETARIRRLLerfgAVRDANVFYWFQNRRSRSRR 97
                     89*****************99*************************************997 PP

2Homeobox47.82.4e-15163223257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      r+R+++++eq+ +Le+ F++   +p ++e +++ + l     + +++V++WFqNrR + ++
  OPUNC08G07010.1 163 RSRWAPKPEQILILESIFNSgMVNPAKDETARIRRLLerfgAVRDANVFYWFQNRRSRSRR 223
                      89*****************99*************************************997 PP

3Wus_type_Homeobox103.91e-333698264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ar+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++
    OPUNC08G07010.1 36 ARSRWAPKPEQILILESIFNSGMVNPAKDETARIRRLLERFGAVRDANVFYWFQNRRSRSRRR 98
                       689**********************************************************98 PP

4Wus_type_Homeobox103.91e-33162224264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        ar+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++
    OPUNC08G07010.1 162 ARSRWAPKPEQILILESIFNSGMVNPAKDETARIRRLLERFGAVRDANVFYWFQNRRSRSRRR 224
                        689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.6773398IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-834103IPR009057Homeodomain-like
SuperFamilySSF466891.07E-1234104IPR009057Homeodomain-like
SMARTSM003899.9E-635102IPR001356Homeobox domain
PfamPF000464.2E-133797IPR001356Homeobox domain
PROSITE profilePS5007111.677159224IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-8160229IPR009057Homeodomain-like
SuperFamilySSF466891.24E-12160229IPR009057Homeodomain-like
SMARTSM003899.9E-6161228IPR001356Homeobox domain
PfamPF000464.2E-13163223IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MDRTASWEVV SRRGELQAPA SHGGGHGHRG GEGEPARSRW APKPEQILIL ESIFNSGMVN  60
PAKDETARIR RLLERFGAVR DANVFYWFQN RRSRSRRRAR QLQQACGAAL HQLPSAAAAA  120
GGGGGGYYHH HHHDVVSRRG ELQAPASHGG GHGHRGGEGE PARSRWAPKP EQILILESIF  180
NSGMVNPAKD ETARIRRLLE RFGAVRDANV FYWFQNRRSR SRRRARQLQQ ACGAIGHHHV  240
HSSSPFLMHG GGGGGGVASA MTVPVAAAAA AASAHFLADD VDAGGDDDLF AISRQMGLMA  300
RGGGGGGGDH HYSSYADSDT TQLSYHHQPT GTTIQVFING VAYDVPSGGA LDMAGTFGRD  360
AMLVHSSGEV LPVDEHGVLI NSLQMGECYY LVGELINY
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0052491e-145AP005249.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0087F21.
GenBankAP0149641e-145AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126161e-145CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649642.11e-122WUSCHEL-related homeobox 10
SwissprotQ6Z3L41e-124WOX10_ORYSJ; WUSCHEL-related homeobox 10
TrEMBLA0A0E0LSS10.0A0A0E0LSS1_ORYPU; Uncharacterized protein
STRINGOPUNC08G07010.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.22e-28WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]