PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G03290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 276aa    MW: 29872 Da    PI: 4.7983
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G03290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B386.32.7e-2764150187
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+kv tpsdv+k++rlv+pk++ae++    + +++l +ed+ g  W+++++y+++s++yv+tkGW++Fv+a +L +gD+v F++ g+
  OPUNC08G03290.1  64 FDKVVTPSDVGKLNRLVVPKQHAERFFPAAAAGTQLCFEDRAGTPWRFRYSYWGSSQSYVMTKGWSRFVRAARLSAGDTVSFSRAGD 150
                      89************************666678889************************************************6654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.3E-3659153IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.09E-2861162IPR015300DNA-binding pseudobarrel domain
CDDcd100171.01E-2362147No hitNo description
PfamPF023621.4E-2464150IPR003340B3 DNA binding domain
PROSITE profilePS5086313.16964161IPR003340B3 DNA binding domain
SMARTSM010191.6E-2064164IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MYMDLTLGGA VLQVEEATEE EEEEEEQALA LGQETAPAAA ALVLGRRHGG GGGGVVAAER  60
EHMFDKVVTP SDVGKLNRLV VPKQHAERFF PAAAAGTQLC FEDRAGTPWR FRYSYWGSSQ  120
SYVMTKGWSR FVRAARLSAG DTVSFSRAGD RYFIDYRHCH RHGGRDISFA ATATMPAAAA  180
WPHFGLVQTA PASYGGHGRS AAATMFLDTV APVVAGHRGE VGPSGQRSFR LFGVNVECGG  240
DVEAAAAEEE DADDDDDDDG DRRGEEMELV MWTNHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5os9_A3e-45581572111B3 domain-containing transcription factor NGA1
5os9_B3e-45581572111B3 domain-containing transcription factor NGA1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649372.11e-125putative B3 domain-containing protein Os08g0157700
SwissprotQ7EZD51e-126Y8577_ORYSJ; Putative B3 domain-containing protein Os08g0157700
TrEMBLA0A0E0LRG10.0A0A0E0LRG1_ORYPU; Uncharacterized protein
STRINGOPUNC08G03290.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141642426
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61970.12e-43B3 family protein