PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G03280.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 773aa    MW: 84421.5 Da    PI: 6.4323
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G03280.8genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.5e-1579123147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT+ E++++++a k++G   W +I +++g ++t+ q++s+ qk+
  OPUNC08G03280.8  79 RERWTEAEHKRFLEALKLYGRA-WQRIEEHVG-TKTAVQIRSHAQKF 123
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575126No hitNo description
SuperFamilySSF466893.14E-1673129IPR009057Homeodomain-like
PROSITE profilePS5129419.14774128IPR017930Myb domain
TIGRFAMsTIGR015571.8E-1677126IPR006447Myb domain, plants
SMARTSM007176.5E-1278126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-879119IPR009057Homeodomain-like
PfamPF002491.6E-1279122IPR001005SANT/Myb domain
CDDcd001671.14E-881124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MARPVTAAVA GDGGWHLFGG GAVLGCFAEA SSLSFRVRPR FKEVFGLSRL TAIGSIQINS  60
SGEEAVVKVR KPYTITKQRE RWTEAEHKRF LEALKLYGRA WQRIEEHVGT KTAVQIRSHA  120
QKFFTKLEKE AINNGTSPGQ AHDIDIPPPR PKRKPNSPYP RKCSLSSETS TREVPNDKTT  180
KSNMTNNSTA QMAGDAVLEK LQRKEISEKG SCSEVLNLFR EVPSASFSSV NKSSSNHGAS  240
RGLEPTKIEV KDVVILERDS ISNGAGKDVK DIDDQEMERL NGIHISSKTD HSHENCLDTS  300
RQQFKPKSNS VETTYVDWSA VKASHYQMDR NGVTDFQATG TEGSHPDQTS DQMGASGTMN  360
QCIHPTLSVD PKFDGNATAQ PFPHNYAAFA PMIQCHCNQD AYRSFANMSS TFSSMLVSTL  420
LSNPAIHAAA RLAASYWPTV DSNTPDPNQE NLSESAQGSH AGSPPNMASI VAATVAAASA  480
WWATQGLLPL FPPPIAFPFV PAPTAPFSTA DVQRAQEKDI DCPIDNAQKE LQETRKQDKS  540
EAMKVIVSSE TDESGKGEVS LHTELKISPA DKADTKPATG ADTSDVFGNK KKQDRSSCGS  600
NTPSSSDIEA DNAPEKQEKA NDKANQASCS NSSAGDNNHR RFRSSASTSD SWKEVSEEGR  660
LAFDALFSRE RLPQSFSPPQ VEGSKEISKE EEDEVTTVTV DLNKNATIID QELDTVDEPR  720
ASFPNELSNL KLKSRRTGFK PYKRCSVEAK ENRVPASDEV GTKRIRLESE TST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2427710.0AK242771.1 Oryza sativa Japonica Group cDNA, clone: J090053J23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649844.10.0PREDICTED: protein LHY isoform X2
RefseqXP_015649845.10.0PREDICTED: protein LHY isoform X2
TrEMBLA0A0E0LRF90.0A0A0E0LRF9_ORYPU; Uncharacterized protein
STRINGLOC_Os08g06110.20.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.33e-39MYB_related family protein