PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G03280.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 718aa    MW: 78775.9 Da    PI: 5.9945
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G03280.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+ E++++++a k++G   W +I +++g ++t+ q++s+ qk+
  OPUNC08G03280.4 24 RERWTEAEHKRFLEALKLYGRA-WQRIEEHVG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-161874IPR009057Homeodomain-like
PROSITE profilePS5129419.1471973IPR017930Myb domain
TIGRFAMsTIGR015571.6E-162271IPR006447Myb domain, plants
SMARTSM007176.5E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-82464IPR009057Homeodomain-like
PfamPF002491.5E-122467IPR001005SANT/Myb domain
CDDcd001671.03E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MEINSSGEEA VVKVRKPYTI TKQRERWTEA EHKRFLEALK LYGRAWQRIE EHVGTKTAVQ  60
IRSHAQKFFT KLEKEAINNG TSPGQAHDID IPPPRPKRKP NSPYPRKCSL SSETSTREVP  120
NDKTTKSNMT NNSTAQMAGD AVLEKLQRKE ISEKGSCSEV LNLFREVPSA SFSSVNKSSS  180
NHGASRGLEP TKIEVKDVVI LERDSISNGA GKDVKDIDDQ EMERLNGIHI SSKTDHSHEN  240
CLDTSRQQFK PKSNSVETTY VDWSAVKASH YQMDRNGVTD FQATGTEGSH PDQTSDQMGA  300
SGTMNQCIHP TLSVDPKFDG NATAQPFPHN YAAFAPMIQC HCNQDAYRSF ANMSSTFSSM  360
LVSTLLSNPA IHAAARLAAS YWPTVDSNTP DPNQENLSES AQGSHAGSPP NMASIVAATV  420
AAASAWWATQ GLLPLFPPPI AFPFVPAPTA PFSTADVQRA QEKDIDCPID NAQKELQETR  480
KQDKSEAMKV IVSSETDESG KGEVSLHTEL KISPADKADT KPATGADTSD VFGNKKKQDR  540
SSCGSNTPSS SDIEADNAPE KQEKANDKAN QASCSNSSAG DNNHRRFRSS ASTSDSWKEV  600
SEEGRLAFDA LFSRERLPQS FSPPQVEGSK EISKEEEDEV TTVTVDLNKN ATIIDQELDT  660
VDEPRASFPN ELSNLKLKSR RTGFKPYKRC SVEAKENRVP ASDEVGTKRI RLESETST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2427710.0AK242771.1 Oryza sativa Japonica Group cDNA, clone: J090053J23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649844.10.0PREDICTED: protein LHY isoform X2
RefseqXP_015649845.10.0PREDICTED: protein LHY isoform X2
TrEMBLA0A0E0LRF80.0A0A0E0LRF8_ORYPU; Uncharacterized protein
STRINGLOC_Os08g06110.20.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.12e-40circadian clock associated 1