PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G02520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 391aa    MW: 40663.8 Da    PI: 8.968
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G02520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81e-12112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+++++ +  +lG+g+W+ I+r     Rt+ q+ s+ qky
  OPUNC08G02520.1 112 AWSEEEHKKFLLGLSKLGKGDWRGISRNYVGSRTPTQVASHAQKY 156
                      7**************************9988*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.102.8E-42745IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.7962742IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.049105161IPR017930Myb domain
SuperFamilySSF466896.4E-16107162IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-16108160IPR006447Myb domain, plants
SMARTSM007177.5E-10109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-9111155IPR009057Homeodomain-like
CDDcd001672.57E-9112157No hitNo description
PfamPF002491.3E-10112156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MTRDGAPPAA PPPGGAGGGG GGADGPRRCS QCGNHGHNAR TCTARGPVKL FGVRIGDKPP  60
PAAAAGGGGG GGMRKSASMG SLAQLAEGSA GGREEGYGSD GNDDKRRKRG EAWSEEEHKK  120
FLLGLSKLGK GDWRGISRNY VGSRTPTQVA SHAQKYFIRQ TSAHRRKRRS SLFDMVIDDS  180
DDQPLSGTSS QEVEVEENLE DAQLVTAPVI PPAPVPMLSS SSVPPPVPAM APVAPGPVLT  240
SASAALPVSA VAPQPDEKEP VASGSNTRET GIAIPEIMPP YGYPMMLPPY YPPAFVPMPY  300
YGYVPVFYAP PGAVQATHEV VKPVAVHSKP PVHIDELYSM SELSLKGETS VKNGTPNSPL  360
PPRPIGRPDR QSAFHGKGPA DGSSNGLIPA K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8372520.0EU837252.1 Oryza sativa Japonica Group clone KCB704E08 myb transcription factor mRNA, complete cds.
GenBankAK0736810.0AK073681.1 Oryza sativa Japonica Group cDNA clone:J033054K18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015651035.10.0PREDICTED: cyclin-dependent kinase 12
TrEMBLA0A0E0LR560.0A0A0E0LR56_ORYPU; Uncharacterized protein
STRINGBGIOSGA027973-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os08g04840.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129002629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.16e-41MYB_related family protein