PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G04680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 775aa    MW: 83375.9 Da    PI: 6.722
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G04680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.9e-16460498240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  OPUNC07G04680.1 460 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 498
                      589**********************************96 PP

2TCR50.93.1e-16545584140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  OPUNC07G04680.1 545 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCEGCKNTF 584
                      589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17459500IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.358460585IPR005172CRC domain
PfamPF036388.7E-12462497IPR005172CRC domain
SMARTSM011141.7E-17545586IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.0E-12547583IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MDTPDRAAAA PAAAFIDSLS PIEPLKSAYS ASSIQAYQSL NITSISSIFT SPHDNAQKES  60
KLSKSSFAEF SESEVCADES HKNKPSKSSN AVRLFACTST LTQATHKITS SVSEGTVEPP  120
EGSNDLPQPG QFDSGSPDHN TTPCHGVRSD LKQGKCRKLQ AFQTAKNNTS EKRKCLFSTE  180
VQLLDGCQPE KLNDEILGCD WDDLISATSG ELIAYDEDHK GVQLAVSNAE SCGFLLSKLT  240
GDGDISDRTH PSSSTQMYYR ELLMEEDQTE NGQLVPDGEK NISTEEIQDN LYEANGSIPT  300
GYKVETQQQR GMRRRCLVFE AAGYSNRIVQ KESVMDLSVS TCKGKSPVQN HSNPGKTPSP  360
RVLRGIGLHL NALALTSKDK MVCQDPMSSL VPSSATQQEA HGKMLSAGEN FVHPGGELLE  420
LQMDDDCSAG VFLGNDHDSS QSNSPQKKRR KADNGDDGEA CKRCSCKKSK CLKLYCECFA  480
AGVYCSEPCS CQGCLNKPIH EEIVLSTRKQ IEFRNPLAFA PKVIRMSDAG QDTGEDPNNT  540
PASARHKRGC NCKKSSCLKK YCECYQGGVG CSSNCRCEGC KNTFGKRDAA VSTEAEEMKQ  600
GGEEAENCGK EKENDLQKAN VQSEDHPFLE LVPITPPFDV SSSLLKPPNF SSAKPPRPTK  660
ARSNSSRSSS KAPGAVHSQK FSKIANSGLN EEIPDILRDD ASPGNCVKTS SPNGKRVSPP  720
HNALSVSPSR KGGRKLILKS IPSFPSLIGD ASSGSSMNSS QSAFNTASPL ALGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1646258212120Protein lin-54 homolog
5fd3_B2e-1646258212120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1446450KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658970.0AK065897.1 Oryza sativa Japonica Group cDNA clone:J013048O08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646690.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A0E0LHQ80.0A0A0E0LHQ8_ORYPU; Uncharacterized protein
STRINGOPUNC07G04680.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-86TESMIN/TSO1-like CXC 2