PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G02500.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 978aa    MW: 107848 Da    PI: 8.6001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G02500.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.8e-08292384147
                      TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqky 47 
                      +++W+  E e+l++++kq   +                                              +W++Ia++   gR++ +c srw+++
  OPUNC07G02500.3 292 KQPWSDVEKEKLAKGIKQQYQEalildsinngsstgdfsavdmayaltntagnfevtaeslrsvlpliNWDKIAAMYLPGRSGAECESRWLNF 384
                      79****************99999***************************************************99888************97 PP

2Myb_DNA-binding28.73e-09392436246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v+q G+++W  Ia t+g++Rt+ qc  r+q 
  OPUNC07G02500.3 392 NAWTAREEKRLLLTVQQQGMNNWINIAVTLGTHRTPFQCLVRYQR 436
                      68**************************************99995 PP

3Myb_DNA-binding43.48e-14446489348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       W +eEd++l  av+ +G++ W ++++ m  gRt++qc +rw+k l
  OPUNC07G02500.3 446 DWAEEEDLQLQAAVNTFGTN-WQLVSASMD-GRTGNQCSNRWRKTL 489
                      6*****************99.*********.************975 PP

4Myb_DNA-binding513.3e-16497542248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+ +Ed++l  avk++G+g+W++Ia+ ++ gRt  qc +rw+++l
  OPUNC07G02500.3 497 GRWSLDEDKRLMVAVKLFGSGSWNKIAQFIP-GRTQSQCNERWRNVL 542
                      8******************************.************986 PP

5Myb_DNA-binding31.44.4e-10549593247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                      g W +eEd +l+  v ++G+  W++Ia ++++ +Rt+++c  rw+k+
  OPUNC07G02500.3 549 GEWRPEEDSILLASVDEFGPC-WSKIAgAKIP-HRTDNMCLRRWRKL 593
                      68*****************88.****945777.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.377287385IPR017877Myb-like domain
SMARTSM007171.3E-5291387IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-11293310IPR009057Homeodomain-like
CDDcd001670.00106356384No hitNo description
Gene3DG3DSA:1.10.10.601.1E-11357398IPR009057Homeodomain-like
SuperFamilySSF466897.33E-5360399IPR009057Homeodomain-like
PROSITE profilePS5129410.49386442IPR017930Myb domain
SMARTSM007179.7E-4390440IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-21390485IPR009057Homeodomain-like
PfamPF002491.1E-5392436IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-10399449IPR009057Homeodomain-like
SMARTSM007171.2E-11443491IPR001005SANT/Myb domain
PfamPF002493.7E-12446488IPR001005SANT/Myb domain
PROSITE profilePS500909.721447489IPR017877Myb-like domain
CDDcd001672.32E-9447489No hitNo description
Gene3DG3DSA:1.10.10.602.7E-14450492IPR009057Homeodomain-like
PROSITE profilePS5129419.971490546IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-18493544IPR009057Homeodomain-like
SuperFamilySSF466896.34E-26495590IPR009057Homeodomain-like
SMARTSM007173.0E-12495544IPR001005SANT/Myb domain
PfamPF002492.9E-15497542IPR001005SANT/Myb domain
CDDcd001671.57E-11498542No hitNo description
Gene3DG3DSA:1.10.10.603.9E-15545598IPR009057Homeodomain-like
SMARTSM007171.9E-8547596IPR001005SANT/Myb domain
PfamPF002493.3E-8549593IPR001005SANT/Myb domain
PROSITE profilePS5129413.267549598IPR017930Myb domain
CDDcd001675.80E-9550593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 978 aa     Download sequence    Send to blast
MDFYSDDSDP DIDEDLQRDL DALRQSCILS GNDPDAAVAQ VSACLAAAAP AAAVGAAANG  60
LSDDDDEEEE DEDLALVRSI RENLLLNKAS PSSPLPRPIC VWPPSDSEDD EDDLETLRAI  120
QRRFSHYHSG TSSGSEINTK NEASKEGSGD LFRNGLDEEF DVEKQNKEAI TRTGFPKAAL  180
LLVDALKKNR ACQKLIRRKM ITIEAKIEEN KDLRDRVKCL LDYQLSCRKA FGKILCQKED  240
PRVRLISSRK PCAQSTKNKD KKTPALFLGP ADNPHVSKYK MVLKQFPMSL QKQPWSDVEK  300
EKLAKGIKQQ YQEALILDSI NNGSSTGDFS AVDMAYALTN TAGNFEVTAE SLRSVLPLIN  360
WDKIAAMYLP GRSGAECESR WLNFDDPLIN HNAWTAREEK RLLLTVQQQG MNNWINIAVT  420
LGTHRTPFQC LVRYQRSLNH CILNKDWAEE EDLQLQAAVN TFGTNWQLVS ASMDGRTGNQ  480
CSNRWRKTLN PERSRVGRWS LDEDKRLMVA VKLFGSGSWN KIAQFIPGRT QSQCNERWRN  540
VLDPDIDLGE WRPEEDSILL ASVDEFGPCW SKIAGAKIPH RTDNMCLRRW RKLCQDKLPS  600
VKAAQQIKKS ILQCNFVDRE TERPAIGPSD LMSLVRSKVD GSDENTSSAQ VRKPRKRSRI  660
PCEDNVLPGD TLNSSPSMNI PLSESIDADA SVNTASANSK KKPSRSRSKK QTDENLAVCD  720
VNNSSNCSSG ARKRKRSITD KNQVVQKKMR GSISGDNEAV VETMGCSISS DNEVAMKRKT  780
GSTSVGEEGT AKKTTRGSLS GKEGEVNKRL RGSISGVQKG ATKQRMRGSV SIDNHGAVMK  840
SKKAPSRKSA KENSKADSMA NAAFGLDLPT VASEYRDADN GSVNNGRIKS TPRPKQMNMT  900
EGSADKFSTS TRLADCMSFG RINGSSRVAR HLCVSVKPLS NMIQSNGPSD DVSAKEGSRS  960
AEAGTSHGIV PGKDSVVM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-263635988159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-263635988159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647432.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647433.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647435.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647436.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647437.10.0PREDICTED: myb-like protein L isoform X1
TrEMBLA0A0E0LGZ40.0A0A0E0LGZ4_ORYPU; Uncharacterized protein
STRINGLOC_Os07g04700.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA024846-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-147myb domain protein 4r1