PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G25680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 414aa    MW: 45686.2 Da    PI: 5.4705
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G25680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-162771147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a k++G   W+ I +++g ++t+ q++s+ qk+
  OPUNC06G25680.1 27 REKWTEEEHDKFLEALKLYGRS-WRQIQEHIG-TKTAVQIRSHAQKF 71
                     789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.88E-162175IPR009057Homeodomain-like
PROSITE profilePS5129421.5852276IPR017930Myb domain
TIGRFAMsTIGR015573.8E-162574IPR006447Myb domain, plants
SMARTSM007172.9E-142674IPR001005SANT/Myb domain
PfamPF002491.6E-142770IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-102767IPR009057Homeodomain-like
CDDcd001672.87E-112972No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MAQLEPNEGM EEFPVKVRKP YTITKQREKW TEEEHDKFLE ALKLYGRSWR QIQEHIGTKT  60
AVQIRSHAQK FFSKVVREPG SNNAIEIPPP RPKRKPLHPY PRKCANSGSD ANPATGQSKL  120
APVSSSSVSD QENGSPISVL SVMQSDAFGS SVSNPSTRCT SPASSDDGNN IPTFTSGEDN  180
NVPCEQTGID QSHKEIDQDR KDVDNMSEED SSEEEVQETS LKLFGKTVVI PDPRKRSSSE  240
PKHENEEQIS QHSREEILRA SSSVGEIPAA YSAPNGWLLS YNSFPFHFGG SSTDARIPPL  300
HVWWPYYGFA PISHPRGLST VMQQTEGSDE SDGGKSHPAE SSSDSVENVQ MTAPHSSRVV  360
ESLGAIYVRE SGSSFELKPS ANSAFLRVKP SNSGDEEDTG WCKQFVAVRK IHVD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8295230.0CT829523.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA128H13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644385.10.0PREDICTED: protein REVEILLE 1 isoform X1
RefseqXP_015644387.10.0PREDICTED: protein REVEILLE 1 isoform X2
RefseqXP_015644388.10.0PREDICTED: protein REVEILLE 1 isoform X2
TrEMBLA0A0E0LFX40.0A0A0E0LFX4_ORYPU; Uncharacterized protein
STRINGORGLA06G0287300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77833647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.18e-38MYB_related family protein