PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G21970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 335aa    MW: 35534.1 Da    PI: 7.2363
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G21970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.27.8e-1376120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I +++g  +t  q++s+ qky
  OPUNC06G21970.1  76 RESWTEPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 120
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.36E-1670126IPR009057Homeodomain-like
PROSITE profilePS5129414.62871125IPR017930Myb domain
TIGRFAMsTIGR015571.2E-1874123IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.1E-675116IPR009057Homeodomain-like
SMARTSM007172.7E-1075123IPR001005SANT/Myb domain
PfamPF002491.3E-1076120IPR001005SANT/Myb domain
CDDcd001678.46E-878121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MSTTPNPLDA AAGSAVAGGG GGGDGGGGGG GGRKQKEKQV VAAPLQPPMA VPAASAVAVG  60
EEARKVRKPY TITKSRESWT EPEHDKFLEA LQLFDRDWKK IEAYVGSKTV IQIRSHAQKY  120
FLKVQKNGTG EHLPPPRPKR KAAHPYPQKA SKNVSQAAIS QPPPLGEQGC VMSMDTSPVI  180
RNANASAAVP SWDNSIAQPL SASHTQGAVA TNNCSSSIES PSATWPTSEA VEQENVLRPL  240
RAMPDFAQVY SFLGSIFDPD TSGHLQTLKA MDPIDVETVL LLMRNLSMNL TSPDFAPHLN  300
LLSSCNSGGD QIKSEGMENL GSPQSCHLPF MVTSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0708710.0AK070871.1 Oryza sativa Japonica Group cDNA clone:J023073K02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656360.10.0PREDICTED: protein REVEILLE 6-like isoform X4
SwissprotQ8H0W31e-97RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0E0LEH80.0A0A0E0LEH8_ORYPU; Uncharacterized protein
STRINGOB06G32000.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.24e-84MYB_related family protein