PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G21040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 357aa    MW: 38137.9 Da    PI: 6.0073
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G21040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.11.6e-075297342
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      ++C+ +e  ++   C+ +   lC+ C   +H        H +vp+
  OPUNC06G21040.1 52 VWVCEVCEMAPAAVTCKADAAVLCAACDADIHDAnplarrHARVPV 97
                     689*****************************44677777888775 PP

2CCT70.54.1e-24283326144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  OPUNC06G21040.1 283 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 326
                      9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.6949IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4095097IPR000315B-box-type zinc finger
SMARTSM003361.9E-125097IPR000315B-box-type zinc finger
PfamPF006432.1E-55196IPR000315B-box-type zinc finger
CDDcd000214.67E-85397No hitNo description
PfamPF062036.4E-18283325IPR010402CCT domain
PROSITE profilePS5101716.896283325IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MELRKYWGVG GRRCGACEAS PAAVHCRGCG GVYLCTACDA RPDHARAAHE RVWVCEVCEM  60
APAAVTCKAD AAVLCAACDA DIHDANPLAR RHARVPVAPI GSAAAAAVAA EAMLFGVAED  120
EAVEEKAAAV AEQQQRQQHG AFNLNVEAKD MKLDYLFSDL DPYLNVEFVR FPHADSVVPN  180
GAGAAIELDF TCGLGVGDGA KQSYSSYTAT DLAHSGSSSE VGVVPEAMCG GGTIDLDFTR  240
PKPQPYMPYT ATPPSHSVSA QVSSVDVGVV PERAAAAAMG EGREARLMRY REKRKNRRFE  300
KTIRYASRKA YAETRPRIKG RFAKRTDHDA DDADADEPAA VPSSYMLDFG YGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4066130.0CU406613.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C109H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641209.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0E0LE710.0A0A0E0LE71_ORYPU; Uncharacterized protein
STRINGLOC_Os06g44450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-35CONSTANS-like 2