PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G19660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 411aa    MW: 45742.8 Da    PI: 9.7421
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G19660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.34.9e-12141230397
                      EE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      k l ++d      + +p kf+++h  +  +++++  ++  + g+ W+v+l  ++ +  ++l++GW  F  a++L    +++F+++g + f  +v
  OPUNC06G19660.1 141 KLLQQEDL---EKMKIPEKFVQQHlaETYTNSHQNAIIVCPLGKFWRVEL--QREQPDMLLRDGWAPFLAAHDLSKDNILLFRYEGYMVF--TV 227
                      55533333...3478**********95555677789999***********..9999999*************************999999..66 PP

                      EEE CS
               B3  95 kvf 97 
                       vf
  OPUNC06G19660.1 228 EVF 230
                      665 PP

2B335.32.1e-113214031096
                      HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      +  s + ++  +f++++g+ +++ +tl+   ++  sW+v ++ + +  +y+ + GW++F+ +n++kegD ++F  ++  ++  +v +
  OPUNC06G19660.1 321 SIHS-LPSVRGTFCSQIGLLEACAITLKTSMKKKGSWRVAFK-TANTYGYINGPGWRKFCLENEVKEGDRLTFNAIE--TAVWHVVI 403
                      4433.3577889***********99999999999*******5.5555579***********************9665..44345555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.7E-117118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-710120IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.09213118IPR003340B3 DNA binding domain
PROSITE profilePS508636.01926118IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.6E-18134235IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-17135239IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.237136233IPR003340B3 DNA binding domain
CDDcd100176.22E-13137230No hitNo description
SMARTSM010196.3E-5139233IPR003340B3 DNA binding domain
PfamPF023628.8E-9147229IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-14310406IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-13311405IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-6312391No hitNo description
SMARTSM010199.6E-4313407IPR003340B3 DNA binding domain
PfamPF023622.2E-8327401IPR003340B3 DNA binding domain
PROSITE profilePS5086310.391344407IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MPLSAGSRRR PKFAAPLLSP ACLHQLSVPG EFAARLDDAG EEERGRRAAA AAVVLVVGPL  60
GKVCRVELCR SEPAGDGEAW LGGGWSEHAA AHGLGEGWGV VLRLERRGVA SLRAFDPGFC  120
LARFCTPHEG MRTKDRPRFI KLLQQEDLEK MKIPEKFVQQ HLAETYTNSH QNAIIVCPLG  180
KFWRVELQRE QPDMLLRDGW APFLAAHDLS KDNILLFRYE GYMVFTVEVF LQNGCLKEYK  240
TAVLYLTDGT EGPSNAPQQS AAKVVVSPVK RKRTRRNEGT CLEGSNRKSR ASPISVKVEP  300
QKKHVSIVSQ NSFTKEMTAY SIHSLPSVRG TFCSQIGLLE ACAITLKTSM KKKGSWRVAF  360
KTANTYGYIN GPGWRKFCLE NEVKEGDRLT FNAIETAVWH VVIVRKMVGD M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047921e-150AP004792.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0505A04.
GenBankAP0149621e-150AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126141e-150CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642658.10.0putative B3 domain-containing protein Os06g0632500 isoform X1
SwissprotQ67VL70.0Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLA0A0E0LDQ20.0A0A0E0LDQ2_ORYPU; Uncharacterized protein
STRINGOPUNC06G19660.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.13e-11B3 family protein