PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G10200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 383aa    MW: 42076.8 Da    PI: 4.7856
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G10200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.31e-052466440
         zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                     r C+ ++  +   +C+ +  +lC++C    H        H++v
  OPUNC06G10200.1 24 RPCDGCGAAPSVVYCRADAAYLCASCDARVHAAncvvsrHERV 66
                     67**************************999656777777765 PP

2zf-B_box26.71.2e-0866111342
         zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                       ++C+ +e+ ++ l C+ +   lC  C ++ H+       H++vp+
  OPUNC06G10200.1  66 VHVCEACERAPAALACRADAAALCVACDVQVHSAnplarrHQRVPV 111
                      689*****************************66899999*99986 PP

3CCT66.48e-23314357144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea++lRYkeK+k RkFeK+irY++RKa+Ae RpR+KGrF+k++
  OPUNC06G10200.1 314 REARVLRYKEKKKARKFEKTIRYATRKAYAEARPRIKGRFAKRS 357
                      9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.7E-52168IPR000315B-box-type zinc finger
CDDcd000212.17E-82466No hitNo description
PROSITE profilePS501199.5132668IPR000315B-box-type zinc finger
PROSITE profilePS5011911.29164111IPR000315B-box-type zinc finger
PfamPF006432.0E-766111IPR000315B-box-type zinc finger
SMARTSM003361.0E-969111IPR000315B-box-type zinc finger
PfamPF062037.3E-17314356IPR010402CCT domain
PROSITE profilePS5101716.281314356IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MNYNFGGNVF DQEIGEAGSC PWARPCDGCG AAPSVVYCRA DAAYLCASCD ARVHAANCVV  60
SRHERVHVCE ACERAPAALA CRADAAALCV ACDVQVHSAN PLARRHQRVP VVPLPAVAIP  120
AASVLAEAVA TTTVLGDKDE EVDSWLLLSK DSDNNNSNNN NNNNNNNNNN NGMYFGEVDE  180
YFDLYYDNRI ENNQQQYGMH EQQEQQQQEM QKEFAEKEGS ECVVPSQITM LSEQQHSGYG  240
VVGADQAVSM TAGVSAYTDS ISNSISFSSM EVGIVPDSTV IDMPNSSILT PAGAINLFSD  300
PSLQMPFHFN SMDREARVLR YKEKKKARKF EKTIRYATRK AYAEARPRIK GRFAKRSDVE  360
IEVDQMFSTA ALSDGSYGTV PWF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5810430.0FJ581043.1 Oryza punctata clone OP_Ba0017E18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641799.10.0PREDICTED: zinc finger protein HD1
SwissprotQ9FDX80.0HD1_ORYSJ; Zinc finger protein HD1
TrEMBLA0A0E0LAD70.0A0A0E0LAD7_ORYPU; Uncharacterized protein
STRINGLOC_Os06g16370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-51CONSTANS-like 2