PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G04650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 296aa    MW: 31682.7 Da    PI: 4.0548
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G04650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.92.1e-07142181443
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      WT  E+ l++++ + +G g+W+ I+r++   +t++q+  +
  OPUNC06G04650.1 142 WTDYEHRLFLNGMRAYGRGDWRNISRYFVRSKTPEQVSVY 181
                      *****************************999**998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129311.682137190IPR017884SANT domain
SMARTSM007171.2E-5138188IPR001005SANT/Myb domain
SuperFamilySSF466896.88E-11142187IPR009057Homeodomain-like
CDDcd001674.92E-7142186No hitNo description
Gene3DG3DSA:1.10.10.602.9E-6142181IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MDATFGMEWT AAELGEARSV VTRVSNDYNA GVGSSNGNGA GDTKHDRIVR ELQATFPSRT  60
MVQVIDLYID LAVEMVQAAA AQPQDAGVGS SVNNNDVVDA GMVFGGAPME GAVEQAPLAP  120
VAVNGGDGEV VNQDNDDDDE FWTDYEHRLF LNGMRAYGRG DWRNISRYFV RSKTPEQVSV  180
YAENYFHIME IAAAMDDNDD DHENNNNNLG GGGQLPAIVG VAHGPAAGHI APATSSNAAT  240
AAANNNVVAP FWAPLLYNPE IEQRMMEMQA QSQQAWDDQQ MKMAAAATPK EGAADK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126141e-125CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankAP0149621e-125AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0028541e-125AP002854.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0014B15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642111.11e-127PREDICTED: uncharacterized protein LOC107275902
TrEMBLA0A0E0L8G90.0A0A0E0L8G9_ORYPU; Uncharacterized protein
STRINGLOC_Os06g07700.11e-124(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1419033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-14Homeodomain-like transcriptional regulator