PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G25370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 268aa    MW: 28458.6 Da    PI: 9.0431
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G25370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.11.9e-13123167347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W+++E+ l++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qk+
  OPUNC05G25370.1 123 PWSEQEHRLFLAGLEKLGKGDWRGISRSFVTTRTPTQVASHAQKF 167
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.439116172IPR017930Myb domain
SuperFamilySSF466892.39E-16117173IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-17119170IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.6E-10120163IPR009057Homeodomain-like
SMARTSM007173.8E-10120170IPR001005SANT/Myb domain
CDDcd001674.90E-9123168No hitNo description
PfamPF002492.1E-10123166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MARRCSDYST ASQRAGEKGG SAAGLRLFGV QLHAAASSPA SSSQSYLHKS YSMDCLRLQV  60
SSPSSLASLL SPPSSSSSPP PSLTSSLLLS IDEGSCERPA ADGYLSDGPH GEATMRERKK  120
GVPWSEQEHR LFLAGLEKLG KGDWRGISRS FVTTRTPTQV ASHAQKFFLR HNSAAKKTNN  180
KRRSSLFDMV QDCDSGKSLA SSHCTNNISA SLSLKVSHQK SADSAWPSSE TPSVSEAQQG  240
HGYGSSHHCS PLDLELGMSL STTPSIGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0685950.0AK068595.1 Oryza sativa Japonica Group cDNA clone:J013154K05, full insert sequence.
GenBankAK0598130.0AK059813.1 Oryza sativa Japonica Group cDNA clone:006-205-B05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638259.11e-132PREDICTED: transcription factor MYB1R1
TrEMBLA0A0E0L6G70.0A0A0E0L6G7_ORYPU; Uncharacterized protein
STRINGBGIOSGA017461-PA1e-139(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.16e-38MYB_related family protein