PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G23480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 523aa    MW: 54800.7 Da    PI: 7.1481
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G23480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.43.8e-1676135256
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                      ++R+++ +eq+++Le  F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k
  OPUNC05G23480.1  76 KPRWNPRPEQIRILEGIFNSgMVNPPRDEIRRIRLQLqeygQVGDANVFYWFQNRKSRTK 135
                      89*****************99*************************************99 PP

2Wus_type_Homeobox107.77e-3575137264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe +++sG+++P+++ei+ri+ +L+eyG+++d+NVfyWFQNrk+R ++k
    OPUNC05G23480.1  75 PKPRWNPRPEQIRILEGIFNSGMVNPPRDEIRRIRLQLQEYGQVGDANVFYWFQNRKSRTKNK 137
                        689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.53E-1170141IPR009057Homeodomain-like
PROSITE profilePS5007110.07472137IPR001356Homeobox domain
SMARTSM003895.8E-674141IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-675138IPR009057Homeodomain-like
CDDcd000861.08E-675137No hitNo description
PfamPF000468.6E-1476135IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MASPNRHWPS MFRSNLACGN IQQQQPDMNG NGCGGGGGGS SSSSFLLSPP AASTGNGKPS  60
LLSSGCEEGT RNPEPKPRWN PRPEQIRILE GIFNSGMVNP PRDEIRRIRL QLQEYGQVGD  120
ANVFYWFQNR KSRTKNKLRA AGHLPHHHGR AALARASPST NIPSAAAAPA PPVTPPRHHH  180
LPAPGVVAAP TTSSSSSSDR SSGSSKSVKP AAALLTSAAQ VGMLPAATAI DLFSPAPAPT  240
SLPLCQLYYH SHPTPLARDD QLTSPESSLL LQWPASQYMP ATELGGVLGS HTQTPAITHP  300
SISPSVLLGL CNEALGQQQE IMDDMSCCSN SKVFGHQYMD MSCTDAVSAV IRDDEKARLG  360
LLHYGIGVTA AAAANPASHH HHHHHLASPV HSPAAAADAS TAAMILPFTT AAATPSNVVA  420
TSSALADQLQ GLLDAGLLQG GAAPPLPSAT VVAVSRDDVT MCTKSTSYSF PAMMHLNVKM  480
FGEAAVLVRY TGETVLVDDS GVTVEPLQQG ATYYVLVTEE AVH
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1241431e-172AC124143.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0053D02, complete sequence.
GenBankAP0149611e-172AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881188.10.0WUSCHEL-related homeobox 12
SwissprotA3B6V00.0WOX12_ORYSJ; WUSCHEL-related homeobox 12
TrEMBLA0A0E0L5S30.0A0A0E0L5S3_ORYPU; Uncharacterized protein
STRINGOPUNC05G23480.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.18e-47homeobox-3
Publications ? help Back to Top
  1. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]