PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G01220.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 292aa    MW: 30336.2 Da    PI: 8.2373
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G01220.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85.2e-202584357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  OPUNC05G01220.2 25 TRWCPTAEQLMILEEMYRGgLRTPNAAQIQQITAHLssygRIEGKNVFYWFQNHKARDRQ 84
                     8*****************99*************************************996 PP

2Wus_type_Homeobox1192.1e-382385264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+Pt+eQ++iLee+y+ GlrtPn+++iq+ita+L++yG+ie+kNVfyWFQN+kaR+rqk
    OPUNC05G01220.2 23 STTRWCPTAEQLMILEEMYRGGLRTPNAAQIQQITAHLSSYGRIEGKNVFYWFQNHKARDRQK 85
                       579***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.6852085IPR001356Homeobox domain
SMARTSM003892.0E-42289IPR001356Homeobox domain
SuperFamilySSF466897.7E-112488IPR009057Homeodomain-like
CDDcd000869.47E-52585No hitNo description
PfamPF000461.2E-172584IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-72584IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAPAVQQQQS GGGGGGSTAA VGSTTRWCPT AEQLMILEEM YRGGLRTPNA AQIQQITAHL  60
SSYGRIEGKN VFYWFQNHKA RDRQKLRRRL CISHHLLSCA HYYAAAHAHH HLALSPTAAA  120
VPPPLLAPLH SSSSYPASSC GGALDHPNSL LSPTSATTPA AAAAAAAAAA AAAYNTTSFY  180
YPLAASAQPP PRTSPASPLF HYNQGGGGVV LPAAEAIGRS SDYSLGKLVD NFGVALEEAF  240
PPQLQPPATT TTMTMTAVVD TAAAAAGGGF CRPLKTLDLF PGGLKEEQHD VV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0789771e-122AC078977.6 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0496H07, complete sequence.
GenBankAM4902441e-122AM490244.1 Oryza sativa mRNA for putative wuschel homeobox protein (wox3 gene).
GenBankAP0149611e-122AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126131e-122CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639083.17e-97putative WUSCHEL-related homeobox 2
SwissprotQ5W7C36e-98WOX2_ORYSJ; Putative WUSCHEL-related homeobox 2
TrEMBLA0A0E0KXU20.0A0A0E0KXU2_ORYPU; Uncharacterized protein
STRINGOPUNC05G01220.10.0(Oryza punctata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.16e-38WOX family protein
Publications ? help Back to Top
  1. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]