PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G24950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 254aa    MW: 28189.3 Da    PI: 9.878
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G24950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.3e-19109168357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      +R+++++eq+++Le l++   r+p+  ++e+++++l    +++ ++V++WFqN++a+e++
  OPUNC04G24950.1 109 TRWNPSAEQIKVLEMLYRGgMRTPNSVQIERITEELgkygRIEGKNVFYWFQNHKARERQ 168
                      8*****************99**************************************97 PP

2Wus_type_Homeobox115.72.3e-37108170365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +tRW+P++eQik+Le+ly+ G+rtPn+ +i+rit+eL +yG+ie+kNVfyWFQN+kaRerqkq
    OPUNC04G24950.1 108 TTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNHKARERQKQ 170
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.928104169IPR001356Homeobox domain
SuperFamilySSF466892.69E-12106174IPR009057Homeodomain-like
SMARTSM003891.8E-6106173IPR001356Homeobox domain
CDDcd000863.69E-5109170No hitNo description
PfamPF000465.3E-17109168IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-7109168IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MRLHHLHVAY LDHKTSSSSS SPAPASISPS ITGSAFPAFS FKCLRPLAPK ISLPEPRKMI  60
APPDFIVPRA RNASKLLNYT VRHQTLLVLF TLNYTRSIDQ VQVPATGTTR WNPSAEQIKV  120
LEMLYRGGMR TPNSVQIERI TEELGKYGRI EGKNVFYWFQ NHKARERQKQ KRAALLTLST  180
LDSSLLPATA NETKEAPEKK EKEVDEGLAS CKRRCKAWGD GAGHGDAVVA TEAADCTVDD  240
VTLELFPLHP QGKA
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8361590.0JF836159.1 Oryza sativa Japonica Group WUSCHEL-like homeobox protein (WOX4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635367.11e-142WUSCHEL-related homeobox 4
SwissprotQ25AM21e-143WOX4_ORYSI; WUSCHEL-related homeobox 4
SwissprotQ7XTV31e-143WOX4_ORYSJ; WUSCHEL-related homeobox 4
TrEMBLA0A0E0KW010.0A0A0E0KW01_ORYPU; Uncharacterized protein
STRINGOPUNC04G24950.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP126923035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-37WUSCHEL related homeobox 4